BDB - Library Details

Library

Library Name: pIT2 X2ELX2LIX2 phage display library

Library ID:

518

Library Length:

Library Complexity:

5e7

Library Titer:

Library From:

Sara Linse (Biochemistry and Structural Biology, Lund University, SE-22100 Lund, Sweden)

Library Randomness:

Library Scheme:

Library Topology:

Linear

Comments:

The library was cloned in frame with gene III in the pIT2 phagemid vector for display at the N terminus of protein 3. The KM13 helper phage is used to rescue the SXkmer/pIII fusion that preferentially packages the single-stranded phagemid DNA in the presence of the phagemid wild-type M13 origin of replication. The use of the phagemid/helper phage also permits monovalent phage display for the selection of higher-affinity binders. DNA codons were chosen to yield the following amino acid sequences of the displayed proteins: SXkmer - side: MKSPEELKRIFEKYAAKEGDPDQLSXXELXXLIXXEFPSLLKGMSTLDDLFQELDKDGDGEVSFEEFQVLVKKISQ where X denotes any amino acid except cysteine. The theoretical number of variants is 5e7. The DNA synthesis and cloning into the pIT2 vector was purchased from Twist Biosciences.

First |

Prev |

518

| Next

| Last