BDB - Target Details

Target

Target Name: Amyloid β peptide (Aβ) (M1-42) fibril, Aβ42 fibril

Target ID:

2171

Target Type:

Protein>Others

Target Sequence:

Synonyms:

Target Source:

Homo sapiens (Human):9606

Target Structure:

Comments:

Aβ was short for amyloid β peptide. Aβ(M1-42) with the sequence MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, here called Aβ42, was recombinantly expressed. Purified aliquots of Aβ42 were separately dissolved in 1 mL 6M GuHCl and monomers were isolated using size exclusion chromatography on a 10/300 Superdex 75 column (GE Healthcare) in 20 mM sodium phosphate, 0.2 mM EDTA, pH 8.0 (Aβ42) or pH 7.4 (Aβ40), in low-binding tubes (Axygen) on ice. Fibrils were prepared from the monomer solutions at quiescent condition at 37 °C in multiple wells of a PEG-ylated polystyrene 96-well plate (Corning 3881) with ThT in some wells. The ThT fluorescence was monitored through the bottom of the plate using a BMG Optima plate reader with excitation at 440 nM and emission at 480 nM until reaching the ThT plateau. Fibrils were collected from wells without ThT.

First |

Prev |

2171

| Next

| Last