| General information | |
| ACovPid: | ACoVP100187 |
| Trivial Name: | HKU4-HR2P3 |
| Amino Acids Sequence: | LDLSDEMAMLQEVVKQLNDSYIDLKELGNYTYYNKW |
| Length: | 36 |
| C-Terminal Modification: | None |
| N-Terminal Modification: | None |
| Chemical Modification: | None |
| Peptide Source: | Tylonycteris sp. Bat coronavirus HKU4 : 694007 |
| Source Description: | This article use the piptide from Tylonycteris sp. Bat coronavirus HKU4, but the source article of Bat coronavirus HKU4 is 《SARS-like virus in the Middle East: A truly bat-related coronavirus causing human diseases》(PMID:23143870) |
| Against Virus: | |
| Inhibition Value Type: | IC50 |
| Inhibitory Effect: | 0.55 |
| Inhibitory Unit: | µM |
| Target Domain Name: | |
| Assay: | Cell-cell fusion |
| Assay Description: | The assay for MERS-CoV S protein-mediated cell–cell fusion was performed as described elsewhere(PMID: 24473083, 30192544, 26164863, 25331705). A defective HIV-1 genome that expresses luciferase as reporter was prepared by co-transfecting 293T cells with the plasmid pNL4-3.luc.RE (encoding Env-defective, luciferase-expressing HIV-1) and pcDNA3.1-MERS-CoV-S plasmid. Briefly, 293T cells transiently co-expressing MERS-CoV S protein and GFP protein on cell surface and in cytoplasm, respectively, were used as the effector cells (293T/S/GFP), and Huh-7 cells were used as the target cells. Then the effector cells (1 × 10^4 cells per well) and target cells (5 × 10^4 cells per well) were cocultured in the wells of a flat-bottom 96-well plate at 37 °C for 2 h in the presence or absence of peptides at the indicated concentrations. Finally, the fused and unfused cells were visualized, photographed and counted under an inverted fluorescence microscope (Nikon Eclipse Ti-S). PBS without peptides was used as no inhibition control, and the median inhibitory concentration (IC50) was calculated using the CalcuSyn software. |
| Anti-CoV activity in vivo: | |
| Reference: | 30646495 |
| Comment: | |
| 3D structure: | |
| Structure Experiment Verified: | NO |
| Similar Peptides: | ACoVP100183   ACoVP100141   ACoVP100179   ACoVP100070   ACoVP100116 |