| General information | |
| ACovPid: | ACoVP100070 |
| Trivial Name: | MERS-HR2P |
| Amino Acids Sequence: | SLTQINTTLLDLTYEMLSLQQVVKALNESYIDLKEL |
| Length: | 36 |
| C-Terminal Modification: | None |
| N-Terminal Modification: | None |
| Chemical Modification: | None |
| Peptide Source: | Tylonycteris sp. Bat coronavirus HKU4 : 694007 |
| Source Description: | This article use the piptide from Tylonycteris sp. Bat coronavirus HKU4, but the reference article(PMID:23143870) is the source article of Bat coronavirus HKU4 |
| Against Virus: | |
| Inhibition Value Type: | IC50 |
| Inhibitory Effect: | 1.06 |
| Inhibitory Unit: | µM |
| Target Domain Name: | |
| Assay: | Pseudotyped virus infection inhibition assay |
| Assay Description: | A pseudovirus bearing CoV S protein or VSV-G protein and a defective HIV-1 genome that expresses luciferase as reporter was produced in 293 T cells, and its titer was quantitated by using HIV-1 p24 ELISA. The pseudovirus was then used to infect target Huh-7 cells (or ACE2/293 T cells for pseudotyped SARS-CoV) (10^4 per well in 96-well plates) in the presence or absence of the test peptide at the indicated concentration. Twelve hours after infection, culture medium was refreshed and then incubated for an additional 48 hours, followed by washing cells with PBS, lysing cells with lysis reagent (Promega), and transferring the cell lysates to 96-well Costar flat-bottom luminometer plates (Corning Costar) for the detection of relative light units using the Firefly Luciferase Assay Kit (Promega) and an Ultra 384 luminometer (Tecan). |
| Anti-CoV activity in vivo: | |
| Reference: | 30989115 |
| Comment: | |
| 3D structure: | |
| Structure Experiment Verified: | NO |
| Similar Peptides: | ACoVP100141 ACoVP100116 ACoVP100139 ACoVP100140 ACoVP100178 |