| General information | |
| ACovPid: | ACoVP100183 |
| Trivial Name: | HKU4-HR2P2 |
| Amino Acids Sequence: | EISKINTTLLDLSDEMAMLQEVVKQLNDSYIDLKEL |
| Length: | 36 |
| C-Terminal Modification: | None |
| N-Terminal Modification: | None |
| Chemical Modification: | None |
| Peptide Source: | Tylonycteris sp. Bat coronavirus HKU4 : 694007 |
| Source Description: | This article use the piptide from Tylonycteris sp. Bat coronavirus HKU4, but the source article of Bat coronavirus HKU4 is 《SARS-like virus in the Middle East: A truly bat-related coronavirus causing human diseases》(PMID:23143870) |
| Against Virus: | |
| Inhibition Value Type: | IC50 |
| Inhibitory Effect: | 0.38 |
| Inhibitory Unit: | µM |
| Target Domain Name: | |
| Assay: | Cell-cell fusion |
| Assay Description: | The package of MERS-CoV pseudovirus was performed described in our previous studies (PMID: 24473083, 26164863). Briefly,we cotransfected 293T cells with plasmid pcDNA3.1-MERS-S with or without Q1020H/R mutationand plasmid pNL4-3.luc.R-E encoding Env-defective, luciferase-expressing HIV-1.Then,the pseudoviruses in the supernatant were collected 48–72 h post-transfection and quantified bythe level of lentivirus p24. Target cells, Huh-7, were preplated in 96-well plates (1×10^4cells per well).The MERS-CoV pseudovirus was premixed with peptide at indicated concentration and incubated for30 min at 37◦C. PBS was used as no inhibition control. Then, the mixture was added to the Huh-7 cells,replaced by fresh medium 12 h post-infection, and then incubated for an additional 48 h. TransducedHuh-7 cells were lysed for detection of relative light units (RLU) according to the luciferase assaysystem manual (Promega, Madison, WI, USA) |
| Anti-CoV activity in vivo: | |
| Reference: | 30646495 |
| Comment: | |
| 3D structure: | |
| Structure Experiment Verified: | NO |
| Similar Peptides: | ACoVP100179 ACoVP100187 ACoVP100141 ACoVP100070 ACoVP100116 |