| General information | |
| ACovPid: | ACoVP100116 |
| Trivial Name: | P1 |
| Amino Acids Sequence: | LTQINTTLLDLTYEMLSLQQVVKALNESYIDLKEL |
| Length: | 35 |
| C-Terminal Modification: | None |
| N-Terminal Modification: | None |
| Chemical Modification: | None |
| Peptide Source: | Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) (MERS-CoV) (Betacoronavirus England 1) : 1263720 |
| Source Description: | P1 corresponded to the full-length HR2 sequence of MERS-CoV spike protein. |
| Against Virus: | Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) (MERS-CoV) (Betacoronavirus England 1) : 1263720 |
| Inhibition Value Type: | IC50 |
| Inhibitory Effect: | 3.013 |
| Inhibitory Unit: | µM |
| Target Domain Name: | HR1 domain of MERS-CoV (Betacoronavirus England 1) |
| Assay: | Pseudotyped virus infection inhibition assay |
| Assay Description: | For the inhibition assay, 100 TCID50s of each pseudovirus was incubated with 10-fold serially diluted peptides from 0.01 nM to 100 µM at 37°C for 30 min. The virus-peptide mixture was then transferred to 96-well plates seeded with Huh7 cells. Each concentration was tested in octuplicate. After a 5-h incubation, the medium was replaced, and the sample was incubated for an additional 48 h at 37°C. The cells were then collected, lysed, and measured for luciferase activity using a GloMax 96 Microplate luminometer (Promega). The 50% effective concentration (EC50) and 95% confidence interval values were calculated using Prism. |
| Anti-CoV activity in vivo: | |
| Reference: | 24067982 |
| Comment: | We identified an HR2-based peptide that could potently inhibit MERS-CoV fusion and entry by using a pseudotyped-virus system. These results lay the groundwork for future inhibitory peptidic drug design. |
| 3D structure: | |
| Structure Experiment Verified: | NO |
| Similar Peptides: | ACoVP100141   ACoVP100070   ACoVP100139   ACoVP100140   ACoVP100178 |
| Target Domain information | |
| Target Domain Full Name: | Heptad repeat 1 (HR1) domain of Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) (MERS-CoV) (Betacoronavirus England 1) spike glycoprotein |
| Target Type: | glycoprotein |
| UniprotID [Sequence]: | K9N5Q8 [994-1044] |
| Target Synonyms: | Alternative name(s) for spike glycoprotein: E2 Peplomer protein S glycoprotein |
| Target Source: | Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) (MERS-CoV) (Betacoronavirus England 1) : 1263720 |
| Target Structure: | 4L72, 4MOD, 4XAK, 4ZPT, 4ZPV, 4ZPW, 5GMQ, 5GR7, 5GSB, 5GSR, 5GSV, 5GSX, 5VYH, 5W9H, 5W9I, 5W9J, 5W9K, 5W9L, 5W9M, 5W9N, 5W9O, 5W9P, 5X4R, 5X59, 5X5C, 5X5F, 5YY5, 5ZVK, 5ZXV, 6C6Y, 6C6Z, 6J11, 6J2J, 6L8Q, 6PXH, 6WAR |