General information
    ACovPid:ACoVP100179
    Trivial Name:HKU4-HR2P1
    Amino Acids Sequence:GPNFAEISKINTTLLDLSDEMAMLQEVVKQLNDSYI
    Length:36
    C-Terminal Modification:None
    N-Terminal Modification:None
    Chemical Modification:None
    Peptide Source:

    Tylonycteris sp. Bat coronavirus HKU4 : 694007

    Source Description:This article use the piptide from Tylonycteris sp. Bat coronavirus HKU4, but the source article of Bat coronavirus HKU4 is 《SARS-like virus in the Middle East: A truly bat-related coronavirus causing human diseases》(PMID:23143870)
    Against Virus:

    The Middle East respiratory syndrome coronavirus (MERS-CoV)

    Inhibition Value Type:IC50
    Inhibitory Effect:1.09
    Inhibitory Unit:µM
    Target Domain Name:
    Assay:Cell-cell fusion
    Assay Description:The assay for MERS-CoV S protein-mediated cell–cell fusion was performed as described elsewhere(PMID: 24473083, 30192544, 26164863, 25331705). A defective HIV-1 genome that expresses luciferase as reporter was prepared by co-transfecting 293T cells with the plasmid pNL4-3.luc.RE (encoding Env-defective, luciferase-expressing HIV-1) and pcDNA3.1-MERS-CoV-S plasmid. Briefly, 293T cells transiently co-expressing MERS-CoV S protein and GFP protein on cell surface and in cytoplasm, respectively, were used as the effector cells (293T/S/GFP), and Huh-7 cells were used as the target cells. Then the effector cells (1 × 10^4 cells per well) and target cells (5 × 10^4 cells per well) were cocultured in the wells of a flat-bottom 96-well plate at 37 °C for 2 h in the presence or absence of peptides at the indicated concentrations. Finally, the fused and unfused cells were visualized, photographed and counted under an inverted fluorescence microscope (Nikon Eclipse Ti-S). PBS without peptides was used as no inhibition control, and the median inhibitory concentration (IC50) was calculated using the CalcuSyn software.
    Anti-CoV activity in vivo:
    Reference:30646495
    Comment:
    3D structure:

    StructureACoVP100179

    Structure Experiment Verified:NO
    Similar Peptides:ACoVP100183   ACoVP100141   ACoVP100187   ACoVP100116   ACoVP100070