General information
    ACovPid:ACoVP100367
    Trivial Name:229E-HR2P
    Amino Acids Sequence:VVEQYNQTILNLTSEISTLENKSAELNYTVQKLQTLIDNINSTLVDLKWL
    Length:50
    C-Terminal Modification:None
    N-Terminal Modification:None
    Chemical Modification:None
    Peptide Source:

    Human coronavirus 229E (HCoV-229E) : 11137

    Source Description:From the heptad repeat region 2 of spike protein of Human coronavirus 229E
    Against Virus:

    Human coronavirus 229E (HCoV-229E) : 11137

    Inhibition Value Type:IC50
    Inhibitory Effect:1.72
    Inhibitory Unit:µM
    Target Domain Name:HR2 domain of HCoV-229E
    Assay:Cytopathic effect (CPE) inhibition assay
    Assay Description:A CPE-based viral inhibition assay for measuring the antiviral activity of peptides against live HCoV-229E was established as we did for detecting anti-Zika virus activity. Briefly, a 50 µL peptide solution was mixed with 50 µL of HCoV-229E (VR-740, 100 TCID50). After incubation at 37 °C for 1 h, the mixture was added to Huh-7 or A549 cells seeded in 96-well plates, followed by incubation at 37 °C for 12 h [53]. The culture supernatant was replaced with fresh and serum-free DMEM. Three to eight days later, when 229E-induced CPE became evident, antiviral activity was detected using the Cell Counting Kit-8 (CCK8, Dojindo, Kumamoto, Kyushu, Japan), according to the instruction manual. Data were then collected by microplate reader (Tecan).
    Anti-CoV activity in vivo:The respiratory tract is a key target of HCoV-229E viral infection [14]. Proteolytic enzymes on the surface of respiratory tract mucosa may cause degradation of the peptides [31,32], resulting in attenuation of their antiviral activity. Therefore, the antiviral activity of 229E-HR2P was verified in the respiratory tract of mice intranasally administered with or without 229E-HR2P. One hour later, upper and lower respiratory tract lavage fluids, respectively, were collected to test their inhibitory activities on HCoV-229E S protein-mediated cell-cell fusion. As shown in Figure 7, the upper and lower respiratory tract lavage fluids from mice treated with 229E-HR2P at 1:32 and 1:16 dilutions, respectively, exhibited significant viral membrane fusion-inhibitory activity. These findings suggested that 229E-HR2P may not be degraded by proteolytic enzymes and that the peptide can maintain effective antiviral activity in both upper and lower respiratory tracts against HCoV-229E infection.
    Reference:29415501
    Comment:229E-HR1P- and 229E-HR2P-mediated inhibition of HCoV-229E infection and replication in A549 cells.
    3D structure:

    StructureACoVP100367

    Structure Experiment Verified:NO
    Similar Peptides:ACoVP100394   ACoVP100395   ACoVP100396   ACoVP100128   ACoVP100183

    Target Domain information
    Target Domain Full Name:Heptad repeat 2 (HR2) domain of Human coronavirus 229E (HCoV-229E) spike glycoprotein
    Target Type:glycoprotein
    UniprotID [Sequence]:

    P15423 [1031-1127]

    Target Synonyms:Alternative name(s) for spike glycoprotein: E2 Peplomer protein S glycoprotein
    Target Source:

    Human coronavirus 229E (HCoV-229E) : 11137

    Target Structure:5YL9, 5ZHY, 5ZUV, 6ATK, 6U7H, 7CYC, 7CYD