General information
    ACovPid:ACoVP100128
    Trivial Name:mHR2
    Amino Acids Sequence:DLSLDFEKLNVTLLDLTYEMNRIQDAIKKLNESYINLKE
    Length:39
    C-Terminal Modification:None
    N-Terminal Modification:None
    Chemical Modification:None
    Peptide Source:

    Murine coronavirus (strain A59) (MHV-A59) (Murine hepatitis virus) : 11142

    Source Description:
    Against Virus:

    Severe acute respiratory syndrome coronavirus (SARS-CoV) : 694009

    Inhibition Value Type:EC50
    Inhibitory Effect:>50
    Inhibitory Unit:µM
    Target Domain Name:HR1 domain of SARS-CoV
    Assay:Immune peroxidase staining assay
    Assay Description:The inhibition experiments was performed on Vero 118 cells in 96-well plates (e4 cells per well). Cells were inoculated in triplicate with 100 TCID50 of SARS-CoV in the presence of various peptide concentrations, ranging from 0.4 to 50 µM, for 1 h at 37°C in a CO2 incubator. Cells were then washed twice with IMDM, and the medium was replaced with IMDM containing 5% FBS. After incubation for 9 h, plates were washed twice with PBS and fixed by 4% formaldehyde for 15 min and 70% ethanol plus 0.5% H2O2 for 15 min at room temperature. After washing the plates twice with PBS plus 0.5% Tween 20 and twice with PBS, the fixed and permeabilized cells were incubated for 1 h at 37°C with a polyclonal antiserum obtained from SARS-CoV-infected ferrets (1:40). Horseradish peroxidase (HRP)-labeled goat-anti-ferret antibodies (Dako) were used as a conjugate in a 1:50 dilution. Reaction was developed with 3-amino-9-ethylcarbazole (AEC; Sigma) according to the manufacturer’s instructions. Experiments were performed in triplicate and carried out in duplo. Infected cells were counted by using the light microscope, and the effective peptide concentration at which 50% of the infection was inhibited (EC50) was calculated by fitting the HR peptide inhibition data to a Langmuir function [normalized number of infected cells = 1/1(1 + [HR peptide]/IC50)].
    Anti-CoV activity in vivo:
    Reference:15150417
    Comment:The inhibitory potency of the SARS-CoV HR2-peptides provides an attractive basis for the development of a therapeutic drug for SARS.
    3D structure:

    StructureACoVP100128

    Structure Experiment Verified:NO
    Similar Peptides:ACoVP100015   ACoVP100014   ACoVP100013   ACoVP100001   ACoVP100011

    Target Domain information
    Target Domain Full Name:Heptad repeat 1 (HR1) domain of Severe acute respiratory syndrome coronavirus (SARS-CoV) spike glycoprotein
    Target Type:glycoprotein
    UniprotID [Sequence]:

    P59594 [902-952]

    Target Synonyms:Alternative name(s) for spike glycoprotein: E2 Peplomer protein S glycoprotein
    Target Source:

    Severe acute respiratory syndrome coronavirus (SARS-CoV) : 694009

    Target Structure:1WNC, 1WYY, 1ZV7, 1ZV8, 1ZVB, 2AJF, 2BEQ, 2BEZ, 2DD8, 2FXP, 2GHV, 2GHW, 2RUM, 2RUN, 2RUO, 3BGF, 3D0G, 3D0H, 3D0I, 3SCI, 3SCJ, 3SCK, 3SCL, 5WRG, 5X4S, 5X58, 5X5B, 5XJK, 5XLR, 5ZVM, 6ACC, 6ACD, 6ACG, 6ACJ, 6ACK, 6CRV, 6CRW, 6CRX, 6CRZ, 6CS0, 6CS1, 6CS2, 6M3W, 6NB6, 6NB7, 6VW1, 6WAQ, 7JN5