| General information | |
| ACovPid: | ACoVP100396 |
| Trivial Name: | FP5 |
| Amino Acids Sequence: | FNATYLNLTGEIDDLEFRSEKLHNTTVELAILIDNINNTLVNLEWLNRIE |
| Length: | 51 |
| C-Terminal Modification: | None |
| N-Terminal Modification: | None |
| Chemical Modification: | None |
| Peptide Source: | Feline coronavirus (FCoV) : 33734 |
| Source Description: | From the heptad repeat region 2 of spike protein of FCoV |
| Against Virus: | Feline coronavirus (FCoV) : 33734 |
| Inhibition Value Type: | IC50 |
| Inhibitory Effect: | 1.33 |
| Inhibitory Unit: | µM |
| Target Domain Name: | |
| Assay: | Plaque reduction assay |
| Assay Description: | Fcwf-4 cells (5 ×10^4 cells/mL) were seeded in 48-well plates and incubated at 37°C for 24 h prior to use. Various concentrations of peptides were incubated with NTU156 at a multiplicity of infection (MOI) of 0.1. After incubation for 1 h, the mixtures of peptide and virus were incubated with fcwf-4 cells for 1 h. Then, the supernatants were removed, and DMEM containing 2% FBS was added to each well. The supernatants were collected 48 h postinfection and incubated with fcwf-4 cells. After 1 h of incubation, the supernatants were removed, and DMEM containing 2% FBS was added. The cells were fixed and stained at 72 h postinfection, and the extent of the cytopathic effect (CPE) was assessed. Based on these results, the fifty percent inhibitory concentrations (IC50) were calculated using an interpolation method. |
| Anti-CoV activity in vivo: | |
| Reference: | 24312629 |
| Comment: | |
| 3D structure: | |
| Structure Experiment Verified: | NO |
| Similar Peptides: | ACoVP100395 ACoVP100394 ACoVP100361 ACoVP100402 ACoVP100249 |