General information
    ACovPid:ACoVP100396
    Trivial Name:FP5
    Amino Acids Sequence:FNATYLNLTGEIDDLEFRSEKLHNTTVELAILIDNINNTLVNLEWLNRIE
    Length:51
    C-Terminal Modification:None
    N-Terminal Modification:None
    Chemical Modification:None
    Peptide Source:

    Feline coronavirus (FCoV) : 33734

    Source Description:From the heptad repeat region 2 of spike protein of FCoV
    Against Virus:

    Feline coronavirus (FCoV) : 33734

    Inhibition Value Type:IC50
    Inhibitory Effect:1.33
    Inhibitory Unit:µM
    Target Domain Name:
    Assay:Plaque reduction assay
    Assay Description:Fcwf-4 cells (5 ×10^4 cells/mL) were seeded in 48-well plates and incubated at 37°C for 24 h prior to use. Various concentrations of peptides were incubated with NTU156 at a multiplicity of infection (MOI) of 0.1. After incubation for 1 h, the mixtures of peptide and virus were incubated with fcwf-4 cells for 1 h. Then, the supernatants were removed, and DMEM containing 2% FBS was added to each well. The supernatants were collected 48 h postinfection and incubated with fcwf-4 cells. After 1 h of incubation, the supernatants were removed, and DMEM containing 2% FBS was added. The cells were fixed and stained at 72 h postinfection, and the extent of the cytopathic effect (CPE) was assessed. Based on these results, the fifty percent inhibitory concentrations (IC50) were calculated using an interpolation method.
    Anti-CoV activity in vivo:
    Reference:24312629
    Comment:
    3D structure:

    StructureACoVP100396

    Structure Experiment Verified:NO
    Similar Peptides:ACoVP100395   ACoVP100394   ACoVP100361   ACoVP100402   ACoVP100249