General information | |
ACovPid: | ACoVP100366 |
Trivial Name: | 229E-HR1P |
Amino Acids Sequence: | AASFNKAMTNIVDAFTGVNDAITQTSQALQTVATALNKIQDVVNQQGNSLNHLTSQ |
Length: | 56 |
C-Terminal Modification: | None |
N-Terminal Modification: | None |
Chemical Modification: | None |
Peptide Source: | Human coronavirus 229E (HCoV-229E) : 11137 |
Source Description: | From the heptad repeat region 1 of spike protein of Human coronavirus 229E |
Against Virus: | Human coronavirus 229E (HCoV-229E) : 11137 |
Inhibition Value Type: | IC50 |
Inhibitory Effect: | 12.7 |
Inhibitory Unit: | µM |
Target Domain Name: | HR1 domain of HCoV-229E |
Assay: | Cytopathic effect (CPE) inhibition assay |
Assay Description: | A CPE-based viral inhibition assay for measuring the antiviral activity of peptides against live HCoV-229E was established as we did for detecting anti-Zika virus activity. Briefly, a 50 µL peptide solution was mixed with 50 µL of HCoV-229E (VR-740, 100 TCID50). After incubation at 37 °C for 1 h, the mixture was added to Huh-7 or A549 cells seeded in 96-well plates, followed by incubation at 37 °C for 12 h [53]. The culture supernatant was replaced with fresh and serum-free DMEM. Three to eight days later, when 229E-induced CPE became evident, antiviral activity was detected using the Cell Counting Kit-8 (CCK8, Dojindo, Kumamoto, Kyushu, Japan), according to the instruction manual. Data were then collected by microplate reader (Tecan). |
Anti-CoV activity in vivo: | |
Reference: | 29415501 |
Comment: | 229E-HR1P- and 229E-HR2P-mediated inhibition of HCoV-229E infection and replication in A549 cells. |
3D structure: | |
Structure Experiment Verified: | NO |
Similar Peptides: | ACoVP100360   ACoVP100260   ACoVP100231   ACoVP100129   ACoVP100130 |
Target Domain information | |
Target Domain Full Name: | Heptad repeat 1 (HR1) domain of Human coronavirus 229E (HCoV-229E) spike glycoprotein |
Target Type: | glycoprotein |
UniprotID [Sequence]: | P15423 [767-886] |
Target Synonyms: | Alternative name(s) for spike glycoprotein: E2 Peplomer protein S glycoprotein |
Target Source: | Human coronavirus 229E (HCoV-229E) : 11137 |
Target Structure: | 5YL9, 5ZHY, 5ZUV, 6ATK, 6U7H, 7CYC, 7CYD |