General information
    ACovPid:ACoVP100366
    Trivial Name:229E-HR1P
    Amino Acids Sequence:AASFNKAMTNIVDAFTGVNDAITQTSQALQTVATALNKIQDVVNQQGNSLNHLTSQ
    Length:56
    C-Terminal Modification:None
    N-Terminal Modification:None
    Chemical Modification:None
    Peptide Source:

    Human coronavirus 229E (HCoV-229E) : 11137

    Source Description:From the heptad repeat region 1 of spike protein of Human coronavirus 229E
    Against Virus:

    Human coronavirus 229E (HCoV-229E) : 11137

    Inhibition Value Type:IC50
    Inhibitory Effect:12.7
    Inhibitory Unit:µM
    Target Domain Name:HR1 domain of HCoV-229E
    Assay:Cytopathic effect (CPE) inhibition assay
    Assay Description:A CPE-based viral inhibition assay for measuring the antiviral activity of peptides against live HCoV-229E was established as we did for detecting anti-Zika virus activity. Briefly, a 50 µL peptide solution was mixed with 50 µL of HCoV-229E (VR-740, 100 TCID50). After incubation at 37 °C for 1 h, the mixture was added to Huh-7 or A549 cells seeded in 96-well plates, followed by incubation at 37 °C for 12 h [53]. The culture supernatant was replaced with fresh and serum-free DMEM. Three to eight days later, when 229E-induced CPE became evident, antiviral activity was detected using the Cell Counting Kit-8 (CCK8, Dojindo, Kumamoto, Kyushu, Japan), according to the instruction manual. Data were then collected by microplate reader (Tecan).
    Anti-CoV activity in vivo:
    Reference:29415501
    Comment:229E-HR1P- and 229E-HR2P-mediated inhibition of HCoV-229E infection and replication in A549 cells.
    3D structure:

    StructureACoVP100366

    Structure Experiment Verified:NO
    Similar Peptides:ACoVP100360   ACoVP100260   ACoVP100231   ACoVP100129   ACoVP100130

    Target Domain information
    Target Domain Full Name:Heptad repeat 1 (HR1) domain of Human coronavirus 229E (HCoV-229E) spike glycoprotein
    Target Type:glycoprotein
    UniprotID [Sequence]:

    P15423 [767-886]

    Target Synonyms:Alternative name(s) for spike glycoprotein: E2 Peplomer protein S glycoprotein
    Target Source:

    Human coronavirus 229E (HCoV-229E) : 11137

    Target Structure:5YL9, 5ZHY, 5ZUV, 6ATK, 6U7H, 7CYC, 7CYD