| General information | |
| ACovPid: | ACoVP100360 |
| Trivial Name: | 229E-HR1P |
| Amino Acids Sequence: | AASFNKAMTNIVDAFTGVNDAITQTSQALQTVATALNKIQDVVNQQGNSLNHLTSQ |
| Length: | 56 |
| C-Terminal Modification: | None |
| N-Terminal Modification: | None |
| Chemical Modification: | None |
| Peptide Source: | Human coronavirus 229E (HCoV-229E) : 11137 |
| Source Description: | From the heptad repeat region 1 of spike protein of Human coronavirus 229E |
| Against Virus: | Human coronavirus 229E (HCoV-229E) : 11137 |
| Inhibition Value Type: | IC50 |
| Inhibitory Effect: | 5.7 |
| Inhibitory Unit: | µM |
| Target Domain Name: | HR1 domain of HCoV-229E |
| Assay: | Cell–cell fusion assay |
| Assay Description: | It has been reported that HCoV-229E-infected cells could form syncytia with uninfected cells in the presence of trypsin, suggesting, in turn, that the S protein on HCoV-229E-infected cells may mediate the fusion between infected and uninfected cells. Accordingly, to assess the inhibitory activities of 229E-HR1P and 229E-HR2P, we established a cell-cell fusion model. To accomplish this, we used Huh-7 cells, naturally expressing the APN receptor of HCoV-229E on the cell surface, and 293T cells that simultaneously coexpress HCoV-229E S protein on the cell surface and Enhanced Green Fluorescent Protein (EGFP) in the cytoplasm (293T/229E/EGFP) as the target and effector cells, respectively (Figure 3a). After coculture of effector cells (293T/229E/EGFP) and target cells (Huh-7) at 37 °C for 3 to 6 h, we could observe cells that had apparently fused, using fluorescence microscopy, which showed larger size and weaker fluorescence than unfused cells. This can be explained by the diffusion of fluorescence into one or more cells that fuse together (Figure 3b). After staining with 4′,6-diamidino-2-phenylindole (DAPI), we could clearly see several nuclei in one fused cell. However, each of the 293T/229E/EGFP cells cultured alone contained only one single nucleus, suggesting that the effector cells cannot spontaneously fuse with each other or do not undergo propagating divisions to influence the assessment of fusion. Besides, 293T/EGFP cells that express no HCoV-229E S protein on cell surface could not fuse with the target cells, and each of these cells also contained only one nucleus. After 24 h, obvious formation of syncytium occurred, as shown in Figure 3c. Consistent with the previous report, trypsin could effectively promote cell-cell fusion in a time- and dose-dependent manner (Figure 3d). This finding confirms that HCoV-229E S protein can mediate membrane fusion between effector cells and target cells, followed by syncytium formation, suggesting that this cell-cell fusion assay can be used to study HCoV-229E S protein-mediated membrane fusion process and identify HCoV-229E fusion and entry inhibitors. |
| Anti-CoV activity in vivo: | |
| Reference: | 29415501 |
| Comment: | |
| 3D structure: | |
| Structure Experiment Verified: | NO |
| Similar Peptides: | ACoVP100360 ACoVP100260 ACoVP100231 ACoVP100129 ACoVP100130 |
| Target Domain information | |
| Target Domain Full Name: | Heptad repeat 1 (HR1) domain of Human coronavirus 229E (HCoV-229E) spike glycoprotein |
| Target Type: | glycoprotein |
| UniprotID [Sequence]: | P15423 [767-886] |
| Target Synonyms: | Alternative name(s) for spike glycoprotein: E2 Peplomer protein S glycoprotein |
| Target Source: | Human coronavirus 229E (HCoV-229E) : 11137 |
| Target Structure: | 5YL9, 5ZHY, 5ZUV, 6ATK, 6U7H, 7CYC, 7CYD |