General information
    ACovPid:ACoVP100260
    Trivial Name:His-HR1
    Amino Acids Sequence:YENQKQIANQFNKAISQIQESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGAISSV
    Length:61
    C-Terminal Modification:None
    N-Terminal Modification:None
    Chemical Modification:None
    Peptide Source:

    Severe acute respiratory syndrome coronavirus (SARS-CoV) : 694009

    Source Description:From the heptad repeat region 1 of spike protein of SARS-CoV
    Against Virus:

    Severe acute respiratory syndrome coronavirus (SARS-CoV) : 694009

    Inhibition Value Type:EC50
    Inhibitory Effect:
    Inhibitory Unit:
    Target Domain Name:HR1 domain of SARS-CoV
    Assay:Pseudotyped virus infection inhibition assay
    Assay Description:To produce HIV‐luc/SARS pseudotyped virus, 10 µg of HIV‐1 luciferase reporter vector pNL4.3.Luc.E‐R‐luc (HIV‐luc) and 10 µg of codon‐optimized SARS‐CoV S protein expression plasmid (pcTSh) were co‐transfected into 293 T cells by calcium phosphate coprecipitation. The construction of the plasmids have been performeddescribed previously(PMID: 7531918, 15358126). The pseudotyped virus was harvested after 48 h of incubation and purified by ultracentrifugation through a CsCl density gradient at 50,000g for 4 h. The supernatant containing the pseudotyped virus was collected, filtered through a 0.45 µm Millipore‐sized membrane and stored at −80°C until used. To measure luciferase activity, 20‐µl aliquots of the pseudotyped virus were added to 100 µl of Luciferase Assay Reagent (Luciferase Assay Substrate pre‐mixed with Luciferase Assay Buffer, Promega, USA). Luciferase activity was measure 10 s using a Wallac Multilabel 1450 Counter (Perkin‐Elmer, Singapore).
    Anti-CoV activity in vivo:
    Reference:18442051
    Comment:
    3D structure:

    StructureACoVP100260

    Structure Experiment Verified:NO
    Similar Peptides:ACoVP100129   ACoVP100130   ACoVP100381   ACoVP100219   ACoVP100231

    Target Domain information
    Target Domain Full Name:Heptad repeat 1 (HR1) domain of Severe acute respiratory syndrome coronavirus (SARS-CoV) spike glycoprotein
    Target Type:glycoprotein
    UniprotID [Sequence]:

    P59594 [902-952]

    Target Synonyms:Alternative name(s) for spike glycoprotein: E2 Peplomer protein S glycoprotein
    Target Source:

    Severe acute respiratory syndrome coronavirus (SARS-CoV) : 694009

    Target Structure:1WNC, 1WYY, 1ZV7, 1ZV8, 1ZVB, 2AJF, 2BEQ, 2BEZ, 2DD8, 2FXP, 2GHV, 2GHW, 2RUM, 2RUN, 2RUO, 3BGF, 3D0G, 3D0H, 3D0I, 3SCI, 3SCJ, 3SCK, 3SCL, 5WRG, 5X4S, 5X58, 5X5B, 5XJK, 5XLR, 5ZVM, 6ACC, 6ACD, 6ACG, 6ACJ, 6ACK, 6CRV, 6CRW, 6CRX, 6CRZ, 6CS0, 6CS1, 6CS2, 6M3W, 6NB6, 6NB7, 6VW1, 6WAQ, 7JN5