| General information | |
| ACovPid: | ACoVP100364 |
| Trivial Name: | 229E-HR1P |
| Amino Acids Sequence: | AASFNKAMTNIVDAFTGVNDAITQTSQALQTVATALNKIQDVVNQQGNSLNHLTSQ |
| Length: | 56 |
| C-Terminal Modification: | None |
| N-Terminal Modification: | None |
| Chemical Modification: | None |
| Peptide Source: | Human coronavirus 229E (HCoV-229E) : 11137 |
| Source Description: | From the heptad repeat region 1 of spike protein of Human coronavirus 229E |
| Against Virus: | Human coronavirus 229E (HCoV-229E) : 11137 |
| Inhibition Value Type: | IC50 |
| Inhibitory Effect: | 13.24 |
| Inhibitory Unit: | µM |
| Target Domain Name: | HR1 domain of HCoV-229E |
| Assay: | Cytopathic effect (CPE) inhibition assay |
| Assay Description: | A CPE-based viral inhibition assay for measuring the antiviral activity of peptides against live HCoV-229E was established as we did for detecting anti-Zika virus activity. Briefly, a 50 µL peptide solution was mixed with 50 µL of HCoV-229E (VR-740, 100 TCID50). After incubation at 37 °C for 1 h, the mixture was added to Huh-7 or A549 cells seeded in 96-well plates, followed by incubation at 37 °C for 12 h [53]. The culture supernatant was replaced with fresh and serum-free DMEM. Three to eight days later, when 229E-induced CPE became evident, antiviral activity was detected using the Cell Counting Kit-8 (CCK8, Dojindo, Kumamoto, Kyushu, Japan), according to the instruction manual. Data were then collected by microplate reader (Tecan). |
| Anti-CoV activity in vivo: | |
| Reference: | 29415501 |
| Comment: | 229E-HR1P- and 229E-HR2P-mediated inhibition of HCoV-229E infection and replication in Huh-7 cells; |
| 3D structure: | |
| Structure Experiment Verified: | NO |
| Similar Peptides: | ACoVP100360 ACoVP100260 ACoVP100231 ACoVP100129 ACoVP100130 |
| Target Domain information | |
| Target Domain Full Name: | Heptad repeat 1 (HR1) domain of Human coronavirus 229E (HCoV-229E) spike glycoprotein |
| Target Type: | glycoprotein |
| UniprotID [Sequence]: | P15423 [767-886] |
| Target Synonyms: | Alternative name(s) for spike glycoprotein: E2 Peplomer protein S glycoprotein |
| Target Source: | Human coronavirus 229E (HCoV-229E) : 11137 |
| Target Structure: | 5YL9, 5ZHY, 5ZUV, 6ATK, 6U7H, 7CYC, 7CYD |