General information
    ACovPid:ACoVP100310
    Trivial Name:HR2P-M2
    Amino Acids Sequence:SLTQINTTLLDLEYEMKKLEEVVKKLEESYIDLKEL
    Length:36
    C-Terminal Modification:None
    N-Terminal Modification:None
    Chemical Modification:None
    Peptide Source:

    Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) (MERS-CoV) (Betacoronavirus England 1) : 1263720

    Source Description:
    Against Virus:

    The Middle East respiratory syndrome coronavirus (MERS-CoV)

    Inhibition Value Type:EC50
    Inhibitory Effect:0.64 ± 0.16
    Inhibitory Unit:µM
    Target Domain Name:HR1 domain of MERS-CoV (Betacoronavirus England 1)
    Assay:Pseudotyped virus infection inhibition assay
    Assay Description:MERS-CoV pseudovirus was generated via cotransfection of 293T cells with the plasmid pNL4-3.luc.RE as well as the pcDNA3.1-MERS-CoV-S plasmid, as previously described(PMID: 23978242). Briefly, 293T cells (ATCC, Manassas, VA) were co-transfected with 20 µg of plasmid encoding Env-defective, luciferase-expressing HIV-1 (pNL4-3.luc.RE) and 20 µg of rMERS-CoV-S plasmid, respectively, into a-T175 tissue culture flask using the calcium phosphate method. Cells were changed into fresh DMEM 8 h later. Supernatants were harvested 72 h post-transfection and used for single-cycle infection. The plasmids encoding vesicular stomatitis virus G protein (VSV-G-pcDNA3.1) and pcDNA3.1 vector were co-transfected with pNL4-3.luc.RE plasmid to generate VSV-G pseudovirus and pseudovirus without Env (Env-) as controls. Peptides at graded concentrations were mixed with the pseudovirus and then incubated for 1 h at room temperature. The mixture was added to Huh-7 or Calu-3 cells, fresh medium was added 12 h later, and the cells were incubated for an additional 48 h at 37 °C. Fluorescence was determined immediately using a luciferase kit (Promega) and an Ultra 384 luminometer (Tecan) after the addition of luciferase substrate (Promega).
    Anti-CoV activity in vivo:
    Reference:29442512
    Comment:For Q1020R-MERS-CoV pseudovirus
    3D structure:

    StructureACoVP100310

    Structure Experiment Verified:NO
    Similar Peptides:ACoVP100139   ACoVP100070   ACoVP100141   ACoVP100178   ACoVP100116

    Target Domain information
    Target Domain Full Name:Heptad repeat 1 (HR1) domain of Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) (MERS-CoV) (Betacoronavirus England 1) spike glycoprotein
    Target Type:glycoprotein
    UniprotID [Sequence]:

    K9N5Q8 [994-1044]

    Target Synonyms:Alternative name(s) for spike glycoprotein: E2 Peplomer protein S glycoprotein
    Target Source:

    Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) (MERS-CoV) (Betacoronavirus England 1) : 1263720

    Target Structure:4L72, 4MOD, 4XAK, 4ZPT, 4ZPV, 4ZPW, 5GMQ, 5GR7, 5GSB, 5GSR, 5GSV, 5GSX, 5VYH, 5W9H, 5W9I, 5W9J, 5W9K, 5W9L, 5W9M, 5W9N, 5W9O, 5W9P, 5X4R, 5X59, 5X5C, 5X5F, 5YY5, 5ZVK, 5ZXV, 6C6Y, 6C6Z, 6J11, 6J2J, 6L8Q, 6PXH, 6WAR