| General information | |
| ACovPid: | ACoVP100308 |
| Trivial Name: | HR2P-M2 |
| Amino Acids Sequence: | SLTQINTTLLDLEYEMKKLEEVVKKLEESYIDLKEL |
| Length: | 36 |
| C-Terminal Modification: | None |
| N-Terminal Modification: | None |
| Chemical Modification: | None |
| Peptide Source: | Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) (MERS-CoV) (Betacoronavirus England 1) : 1263720 |
| Source Description: | |
| Against Virus: | |
| Inhibition Value Type: | EC50 |
| Inhibitory Effect: | 1.07 ± 0.21 |
| Inhibitory Unit: | µM |
| Target Domain Name: | HR1 domain of MERS-CoV (Betacoronavirus England 1) |
| Assay: | Pseudotyped virus infection inhibition assay |
| Assay Description: | MERS-CoV pseudovirus was generated via cotransfection of 293T cells with the plasmid pNL4-3.luc.RE as well as the pcDNA3.1-MERS-CoV-S plasmid, as previously described(PMID: 23978242). Briefly, 293T cells (ATCC, Manassas, VA) were co-transfected with 20 µg of plasmid encoding Env-defective, luciferase-expressing HIV-1 (pNL4-3.luc.RE) and 20 µg of rMERS-CoV-S plasmid, respectively, into a-T175 tissue culture flask using the calcium phosphate method. Cells were changed into fresh DMEM 8 h later. Supernatants were harvested 72 h post-transfection and used for single-cycle infection. The plasmids encoding vesicular stomatitis virus G protein (VSV-G-pcDNA3.1) and pcDNA3.1 vector were co-transfected with pNL4-3.luc.RE plasmid to generate VSV-G pseudovirus and pseudovirus without Env (Env-) as controls. Peptides at graded concentrations were mixed with the pseudovirus and then incubated for 1 h at room temperature. The mixture was added to Huh-7 or Calu-3 cells, fresh medium was added 12 h later, and the cells were incubated for an additional 48 h at 37 °C. Fluorescence was determined immediately using a luciferase kit (Promega) and an Ultra 384 luminometer (Tecan) after the addition of luciferase substrate (Promega). |
| Anti-CoV activity in vivo: | |
| Reference: | 29442512 |
| Comment: | For WT MERS-CoV pseudovirus |
| 3D structure: | |
| Structure Experiment Verified: | NO |
| Similar Peptides: | ACoVP100139   ACoVP100070   ACoVP100141   ACoVP100178   ACoVP100116 |
| Target Domain information | |
| Target Domain Full Name: | Heptad repeat 1 (HR1) domain of Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) (MERS-CoV) (Betacoronavirus England 1) spike glycoprotein |
| Target Type: | glycoprotein |
| UniprotID [Sequence]: | K9N5Q8 [994-1044] |
| Target Synonyms: | Alternative name(s) for spike glycoprotein: E2 Peplomer protein S glycoprotein |
| Target Source: | Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) (MERS-CoV) (Betacoronavirus England 1) : 1263720 |
| Target Structure: | 4L72, 4MOD, 4XAK, 4ZPT, 4ZPV, 4ZPW, 5GMQ, 5GR7, 5GSB, 5GSR, 5GSV, 5GSX, 5VYH, 5W9H, 5W9I, 5W9J, 5W9K, 5W9L, 5W9M, 5W9N, 5W9O, 5W9P, 5X4R, 5X59, 5X5C, 5X5F, 5YY5, 5ZVK, 5ZXV, 6C6Y, 6C6Z, 6J11, 6J2J, 6L8Q, 6PXH, 6WAR |