General information
    ACovPid:ACoVP100173
    Trivial Name:HR2P-M2
    Amino Acids Sequence:SLTQINTTLLDLEYEMKKLEEVVKKLEESYIDLKEL
    Length:36
    C-Terminal Modification:None
    N-Terminal Modification:None
    Chemical Modification:None
    Peptide Source:

    Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) (MERS-CoV) (Betacoronavirus England 1) : 1263720

    Source Description:
    Against Virus:

    Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) (MERS-CoV) (MERS-CoV mutants isolated - I529T)

    Inhibition Value Type:IC50
    Inhibitory Effect:0.098
    Inhibitory Unit:µM
    Target Domain Name:RBD of MERS-CoV (Betacoronavirus England 1)
    Assay:Pseudotyped virus infection inhibition assay
    Assay Description:HR2P-M2 and m336 were mixed at the indicated molarconcentration ratio, while HR2P-M2 alone and m336 alone were included as controls. The mixtureswere serially diluted and tested for their inhibitory activity on MERS-CoV pseudovirus infection as described above. Each sample was tested in triplicate, and data were analyzed for synergistic effect bycalculating the combination index (CI), using the CalcuSyn program. CI values of less than 1 and more than 1 indicate synergy and antagonism, respectively, and synergy was divided into different strengths, accordingto CI values, as follows: less than 0.1 indicates very strong synergism; 0.1 to 0.3 indicates strong synergism;0.3 to 0.7 indicates synergism; 0.7 to 0.85 indicates moderate synergism; and 0.85 to 0.90 indicates slightsynergism. Fold of potency enhancement was calculated with the ratio of concentrations of inhibitor testing alone and in combination.
    Anti-CoV activity in vivo:
    Reference:30621343
    Comment:The molar concentration ratio of HR2P-M2 and m336 in combination against wildtype virus, viruses with mutations in RBD, and those in HR1 is 10,000:1, 4500:1, and 10,000:1, respectively.
    3D structure:

    StructureACoVP100173

    Structure Experiment Verified:NO
    Similar Peptides:ACoVP100139   ACoVP100070   ACoVP100141   ACoVP100178   ACoVP100116

    Target Domain information
    Target Domain Full Name:Receptor-binding domain (RBD) of Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) (MERS-CoV) (Betacoronavirus England 1) spike glycoprotein
    Target Type:glycoprotein
    UniprotID [Sequence]:

    K9N5Q8 [377-662]

    Target Synonyms:Alternative name(s) for spike glycoprotein: E2 Peplomer protein S glycoprotein
    Target Source:

    Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) (MERS-CoV) (Betacoronavirus England 1) : 1263720

    Target Structure:4L72, 4MOD, 4XAK, 4ZPT, 4ZPV, 4ZPW, 5GMQ, 5GR7, 5GSB, 5GSR, 5GSV, 5GSX, 5VYH, 5W9H, 5W9I, 5W9J, 5W9K, 5W9L, 5W9M, 5W9N, 5W9O, 5W9P, 5X4R, 5X59, 5X5C, 5X5F, 5YY5, 5ZVK, 5ZXV, 6C6Y, 6C6Z, 6J11, 6J2J, 6L8Q, 6PXH, 6WAR