| General information | |
| ACovPid: | ACoVP100158 |
| Trivial Name: | HR2P-M2 |
| Amino Acids Sequence: | SLTQINTTLLDLEYEMKKLEEVVKKLEESYIDLKEL |
| Length: | 36 |
| C-Terminal Modification: | None |
| N-Terminal Modification: | None |
| Chemical Modification: | None |
| Peptide Source: | Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) (MERS-CoV) (Betacoronavirus England 1) : 1263720 |
| Source Description: | |
| Against Virus: | Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) (MERS-CoV) (Betacoronavirus England 1) : 1263720 |
| Inhibition Value Type: | IC50 |
| Inhibitory Effect: | 0.11 |
| Inhibitory Unit: | µM |
| Target Domain Name: | RBD of MERS-CoV (Betacoronavirus England 1) |
| Assay: | Pseudotyped virus infection inhibition assay |
| Assay Description: | The author tested the potential synergistic activity of the HR2P-M2/m336 combination on MERS-CoV S protein-mediated cell–cell fusion. We adjusted the molar concentration ratio of HR2P-M2 and m336 in the combination to 4500:1, since the IC50 values of HR2P-M2 and m336 for inhibiting MERS-CoV S protein-mediated cell–cell fusion in our preliminary studies were about 700 nM and 0.15 nM, respectively. |
| Anti-CoV activity in vivo: | |
| Reference: | 30621343 |
| Comment: | Each sample was tested in triplicate, and the mean values are presented. The molar concentration ratio ofHR2P-M2 and m336 in combination is 4500:1. |
| 3D structure: | |
| Structure Experiment Verified: | NO |
| Similar Peptides: | ACoVP100139   ACoVP100070   ACoVP100141   ACoVP100178   ACoVP100116 |
| Target Domain information | |
| Target Domain Full Name: | Receptor-binding domain (RBD) of Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) (MERS-CoV) (Betacoronavirus England 1) spike glycoprotein |
| Target Type: | glycoprotein |
| UniprotID [Sequence]: | K9N5Q8 [377-662] |
| Target Synonyms: | Alternative name(s) for spike glycoprotein: E2 Peplomer protein S glycoprotein |
| Target Source: | Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) (MERS-CoV) (Betacoronavirus England 1) : 1263720 |
| Target Structure: | 4L72, 4MOD, 4XAK, 4ZPT, 4ZPV, 4ZPW, 5GMQ, 5GR7, 5GSB, 5GSR, 5GSV, 5GSX, 5VYH, 5W9H, 5W9I, 5W9J, 5W9K, 5W9L, 5W9M, 5W9N, 5W9O, 5W9P, 5X4R, 5X59, 5X5C, 5X5F, 5YY5, 5ZVK, 5ZXV, 6C6Y, 6C6Z, 6J11, 6J2J, 6L8Q, 6PXH, 6WAR |