General information
    ACovPid:ACoVP100157
    Trivial Name:HR2P-M2
    Amino Acids Sequence:SLTQINTTLLDLEYEMKKLEEVVKKLEESYIDLKEL
    Length:36
    C-Terminal Modification:None
    N-Terminal Modification:None
    Chemical Modification:None
    Peptide Source:

    Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) (MERS-CoV) (Betacoronavirus England 1) : 1263720

    Source Description:
    Against Virus:

    Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) (MERS-CoV) (Betacoronavirus England 1) : 1263720

    Inhibition Value Type:IC50
    Inhibitory Effect:0.511
    Inhibitory Unit:µM
    Target Domain Name:RBD of MERS-CoV (Betacoronavirus England 1)
    Assay:Pseudotyped virus infection inhibition assay
    Assay Description:The author tested the potential synergistic activity of the HR2P-M2/m336 combination on MERS-CoV S protein-mediated cell–cell fusion. We adjusted the molar concentration ratio of HR2P-M2 and m336 in the combination to 4500:1, since the IC50 values of HR2P-M2 and m336 for inhibiting MERS-CoV S protein-mediated cell–cell fusion in our preliminary studies were about 700 nM and 0.15 nM, respectively.
    Anti-CoV activity in vivo:
    Reference:30621343
    Comment:Each sample was tested in triplicate, and the mean values are presented. The molar concentration ratio ofHR2P-M2 and m336 in combination is 4500:1.
    3D structure:

    StructureACoVP100157

    Structure Experiment Verified:NO
    Similar Peptides:ACoVP100139   ACoVP100070   ACoVP100141   ACoVP100178   ACoVP100116

    Target Domain information
    Target Domain Full Name:Receptor-binding domain (RBD) of Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) (MERS-CoV) (Betacoronavirus England 1) spike glycoprotein
    Target Type:glycoprotein
    UniprotID [Sequence]:

    K9N5Q8 [377-662]

    Target Synonyms:Alternative name(s) for spike glycoprotein: E2 Peplomer protein S glycoprotein
    Target Source:

    Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) (MERS-CoV) (Betacoronavirus England 1) : 1263720

    Target Structure:4L72, 4MOD, 4XAK, 4ZPT, 4ZPV, 4ZPW, 5GMQ, 5GR7, 5GSB, 5GSR, 5GSV, 5GSX, 5VYH, 5W9H, 5W9I, 5W9J, 5W9K, 5W9L, 5W9M, 5W9N, 5W9O, 5W9P, 5X4R, 5X59, 5X5C, 5X5F, 5YY5, 5ZVK, 5ZXV, 6C6Y, 6C6Z, 6J11, 6J2J, 6L8Q, 6PXH, 6WAR