| General information | |
| ACovPid: | ACoVP100156 |
| Trivial Name: | HR2P-M2 |
| Amino Acids Sequence: | SLTQINTTLLDLEYEMKKLEEVVKKLEESYIDLKEL |
| Length: | 36 |
| C-Terminal Modification: | None |
| N-Terminal Modification: | None |
| Chemical Modification: | None |
| Peptide Source: | Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) (MERS-CoV) (Betacoronavirus England 1) : 1263720 |
| Source Description: | |
| Against Virus: | Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) (MERS-CoV) (Betacoronavirus England 1) : 1263720 |
| Inhibition Value Type: | IC50 |
| Inhibitory Effect: | 0.069 |
| Inhibitory Unit: | µM |
| Target Domain Name: | RBD of MERS-CoV (Betacoronavirus England 1) |
| Assay: | Pseudotyped virus infection inhibition assay |
| Assay Description: | A MERS-CoV pseudovirus inhibition assay was performed. A defective HIV-1 genome that expresses luciferase as reporter was prepared by co-transfecting 293T cells with the plasmid pNL4-3.luc.RE (encoding Env-defective, luciferase-expressing HIV-1) and pcDNA3.1-MERS-CoV-S plasmid. Briefly, Huh-7 cells were seeded (10^4 cells/well) into a 96-well plate and incubated overnight at 37 °C. MERS-CoV pseudovirus was incubated with a serially diluted inhibitor for 30 min at 37 °C, followed by the addition of Huh-7 cells. The cells were incubated with or without pseudovirus as virus control and cell control, respectively. The culture was replaced with fresh medium 12 h post-infection and incubated for an additional 72 h. Cells were lysed using lysis reagent (Promega, Madison, WI, USA), and cell lysates were transferred to a 96-well Costar flat-bottom luminometer plate (Corning Costar, New York, NY, USA), followed by the addition of luciferase substrate (Promega) to measure luminescence using an Infinite M200 PRO (Tecan, GröDig, Austria). |
| Anti-CoV activity in vivo: | |
| Reference: | 30621343 |
| Comment: | Each sample was tested in triplicate, and the mean values are presented. Ratio of molar concentration ofHR2P-M2 and m336 in combination is 10,000:1. |
| 3D structure: | |
| Structure Experiment Verified: | NO |
| Similar Peptides: | ACoVP100139   ACoVP100070   ACoVP100141   ACoVP100178   ACoVP100116 |
| Target Domain information | |
| Target Domain Full Name: | Receptor-binding domain (RBD) of Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) (MERS-CoV) (Betacoronavirus England 1) spike glycoprotein |
| Target Type: | glycoprotein |
| UniprotID [Sequence]: | K9N5Q8 [377-662] |
| Target Synonyms: | Alternative name(s) for spike glycoprotein: E2 Peplomer protein S glycoprotein |
| Target Source: | Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) (MERS-CoV) (Betacoronavirus England 1) : 1263720 |
| Target Structure: | 4L72, 4MOD, 4XAK, 4ZPT, 4ZPV, 4ZPW, 5GMQ, 5GR7, 5GSB, 5GSR, 5GSV, 5GSX, 5VYH, 5W9H, 5W9I, 5W9J, 5W9K, 5W9L, 5W9M, 5W9N, 5W9O, 5W9P, 5X4R, 5X59, 5X5C, 5X5F, 5YY5, 5ZVK, 5ZXV, 6C6Y, 6C6Z, 6J11, 6J2J, 6L8Q, 6PXH, 6WAR |