Details

Structure visualisation

	Display styles : Spacefill Wire Ball&stick Cartoon	Display color : Default Color by B-factor Color by sec.structure Color by element
Spin on/off

Entry information

Complex
AACDB_ID:	7117
PDBID:	5H30
Chains:	GH_A
Organism:	Zika virus, Homo sapiens
Method:	EM
Resolution (Å):	4.40
Reference:	10.1038/ncomms13679
Antibody
Antibody:	C10 Fab
Antibody mutation:	No
INN (Clinical Trial):
Antigen
Antigen:	Zika virus envelope glycoprotein E
Antigen mutation:	No
Durg Target:

Sequence information

Antibody

Heavy Chain: G
Mutation: NULL

>5H30_G|Chain G, I, K|IgG C10 heavy chain|Homo sapiens (9606)
EVQLVESGAEVKKPGASVKVSCKASGYTFTSYAMHWVRQAPGQRLEWMGWINAGNGNTKYSQKFQDRVTITRDTSASTAYMELSSLRSEDTAIYYCARDKVDDYGDYWFPTLWYFDYWGQGTLVTVS

Light Chain: H
Mutation: NULL

>5H30_H|Chain H, J[auth L], L[auth M]|IgG C10 light chain|Homo sapiens (9606)
SALTQPASVSGSPGQSITISCTGTSSDVGGFNYVSWFQQHPGKAPKLMLYDVTSRPSGVSSRFSGSKSGNTASLTISGLQAEDEADYYCSSHTSRGTWVFGGGTKLTVL

Antigen

Chain: A
Mutation: NULL

>5H30_A|Chain A, B, D[auth C]|structural protein E|Zika virus (64320)
IRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIELVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWGNGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHETDENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWFHDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAEMDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAGTDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVGEKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFGAAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSA

Interaction

1、Solvent accessible surface areas (SASA) were calculated (Naccess V2.1.1) for each residue in antibody and antigen, respectively. The residues with SASA loss in binding of more than 1Å² were classified as interacting residues.

Interacting residues (ΔSASA based)

H: GLY28 PHE29 ASN30 SER92 ARG93

A: ASP71 SER72 ARG73 CYS74 GLY102 ASN103 GLY104 CYS105

2、We defined interacting paratope-epitope residues by a distance cutoff of < 5Å . Two amino acids are considered as interacting residues if they have at least one atom within a distance of 5 Å from any atom.

Interacting residues (Atom distance based)

Within the threshold, the structure has no interacting amino acids and cannot be displayed. This may be due to the following reasons:
1. The method used to determine the structure is electron microscopy or nuclear magnetic resonance, which results in too low resolution;
2. the coordinates of some amino acids involved in the interaction in the structure were not detected due to technical limitations. The results are less based on atomic coordinates, but the antibody does target the antigen.

Download

Download sequences
Download structure
Download interacting residues (ΔSASA based)
Download interacting residues (Distance based)