Details

Structure visualisation

Display styles :





Display color :





Entry information

Complex
AACDB_ID: 6707
PDBID: 3V4V
Chains: MN_D
Organism: Homo sapiens, Mus musculus
Method: XRD
Resolution (Å): 3.10
Reference: 10.1083/jcb.201110023
Antibody
Antibody: Act-1 Fab
Antibody mutation: No
INN (Clinical Trial):
Antigen
Antigen: Integrin beta-7
Antigen mutation: No
Durg Target: P26010

Sequence information

Antibody

Heavy Chain: M
Mutation: NULL

>3V4V_M|Chain C[auth H], G[auth M]|MONOCLONAL ANTIBODY Act-1 HEAVY CHAIN|Mus musculus (10090)
QVQLQQPGAELVKPGTSVKLSCKGYGYTFTSYWMHWVKQRPGQGLEWIGEIDPSESNTNYNQKFKGKATLTVDISSSTAYMQLSSLTSEDSAVYYCARGGYDGWDYAIDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLESDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIV

Light Chain: N
Mutation: NULL

>3V4V_N|Chain D[auth L], H[auth N]|MONOCLONAL ANTIBODY Act-1 LIGHT CHAIN|Mus musculus (10090)
DVVVTQTPLSLPVSFGDQVSISCRSSQSLAKSYGNTYLSWYLHKPGQSPQLLIYGISNRFSGVPDRFSGSGSGTDFTLKISTIKPEDLGMYYCLQGTHQPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWNIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN

Antigen

Chain: D
Mutation: NULL

>3V4V_D|Chain B, F[auth D]|Integrin beta-7|Homo sapiens (9606)
ELDAKIPSTGDATEWRNPHLSMLGSCQPAPSCQKCILSHPSCAWCKQLNFTASGEAEARRCARREELLARGCPLEELEEPRGQQEVLQDQPLSQGARGEGATQLAPQRVRVTLRPGEPQQLQVRFLRAEGYPVDLYYLMDLSYSMKDDLERVRQLGHALLVRLQEVTHSVRIGFGSFVDKTVLPFVSTVPSKLRHPCPTRLERCQSPFSFHHVLSLTGDAQAFEREVGRQSVSGNLDSPEGGFDAILQAALCQEQIGWRNVSRLLVFTSDDTFHTAGDGKLGGIFMPSDGHCHLDSNGLYSRSTEFDYPSVGQVAQALSAANIQPIFAVTSAALPVYQELSKLIPKSAVGELSEDSSNVVQLIMDAYNSLSSTVTLEHSSLPPGVHISYESQCEGPEKREGKAEDRGQCNHVRINQTVTFWVSLQATHCLPEPHLLRLRALGFSEELIVELHTLCDCNCSDTQPQAPHCSDGQGHLQCGVCSCAPGRLGRLCESRGLENLYFQ

Interaction

1、Solvent accessible surface areas (SASA) were calculated (Naccess V2.1.1) for each residue in antibody and antigen, respectively. The residues with SASA loss in binding of more than 1Å2 were classified as interacting residues.

Interacting residues (ΔSASA based)

M: THR30 SER31 TYR32 TRP33 ASP52 PRO53 SER54 GLY100 TYR101 ASP102 GLY103 TRP104

N: SER32 TYR33 GLY34 TYR54

D: ARG194 HIS195 PRO198 THR199 ARG200 LEU201 GLU202 ARG203 CYS204 GLN205 GLY228 ARG229 GLN230 SER231

2、We defined interacting paratope-epitope residues by a distance cutoff of < 5Å . Two amino acids are considered as interacting residues if they have at least one atom within a distance of 5 Å from any atom.

Interacting residues (Atom distance based)

Within the threshold, the structure has no interacting amino acids and cannot be displayed. This may be due to the following reasons:
1. The method used to determine the structure is electron microscopy or nuclear magnetic resonance, which results in too low resolution;
2. the coordinates of some amino acids involved in the interaction in the structure were not detected due to technical limitations. The results are less based on atomic coordinates, but the antibody does target the antigen.

Download

Download sequences
Download structure
Download interacting residues (ΔSASA based)
Download interacting residues (Distance based)