| Complex | |
| AACDB_ID: | 579 |
| PDBID: | 3LH2 |
| Chains: | KO_V |
| Organism: | synthetic construct, Homo sapiens |
| Method: | XRD |
| Resolution (Å): | 2.65 |
| Reference: | 10.1016/j.str.2010.06.010 |
| Antibody | |
| Antibody: | 4E10 Fv |
| Antibody mutation: | No |
| INN (Clinical Trial): | |
| Antigen | |
| Antigen: | HIV epitope-scaffold 4E10_1VI7A_S0_002_N(T88) |
| Antigen mutation: | No |
| Durg Target: | |
Antibody
Heavy Chain: K
Mutation: NULL
| >3LH2_K|Chain B[auth H], D[auth I], F[auth J], L[auth K]|Fv 4E10 heavy chain|Homo sapiens (9606) GSQVQLVQSGAEVKRPGSSVTVSCKASGGSFSTYALSWVRQAPGRGLEWMGGVIPLLTITNYAPRFQGRITITADRSTSTAYLELNSLRPEDTAVYYCAREGTTGAGWLGKPIGAFAHWGQGTLVTVSSLEHHHHHH |
Light Chain: O
Mutation: NULL
| >3LH2_O|Chain G[auth L], H[auth M], I[auth N], K[auth O]|Fv 4E10 light chain|Homo sapiens (9606) MAEIVLTQSPGTQSLSPGERATLSCRASQSVGNNKLAWYQQRPGQAPRLLIYGASSRPSGVADRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGQSLSTFGQGTKVEVKLVPR |
Antigen
Chain: V
Mutation: NULL
| >3LH2_V|Chain A[auth S], C[auth T], E[auth U], J[auth V]|4E10_1VI7A_S0_002_N (T88)|ARTIFICIAL GENE (32630) HHHHHHLTEYTLQANWFDITGILWLLGQVDGKIINSDVQAFVLLRVALPAAKVAEFSAKLADFSGGSLQLLAIEEE |
Interaction
1、Solvent accessible surface areas (SASA) were calculated (Naccess V2.1.1) for each residue in antibody and antigen, respectively. The residues with SASA loss in binding of more than 1Å2 were classified as interacting residues.
Interacting residues (ΔSASA based)
| Chain residues position delta_SASA
: residuesposition K: THR31 ALA33 SER35 TRP47 GLY50 VAL51 ILE52 LEU54 LEU55 ILE57 THR58 ASN59 GLU99 LEU107 GLY108 LYS109 PRO110 GLY112 PHE114 O: ASN31 LYS33 TYR92 GLY93 GLN94 SER95 SER97 V: ASN15 TRP16 PHE17 ASP18 ILE19 THR20 GLY21 LEU23 TRP24 LEU25 ILE33 SER36 ASP37 VAL38 |
2、We defined interacting paratope-epitope residues by a distance cutoff of < 6 Å . Two amino acids are considered as interacting residues if they have at least one atom within a distance of 6 Å from any atom.
Interacting residues (Atom distance based)