| Complex | |
| AACDB_ID: | 558 |
| PDBID: | 3K7U |
| Chains: | A_C |
| Organism: | Lama glama, Trypanosoma brucei |
| Method: | XRD |
| Resolution (Å): | 2.10 |
| Reference: | 10.1016/j.jsb.2010.10.007 |
| Antibody | |
| Antibody: | 3K7U VHH |
| Antibody mutation: | No |
| INN (Clinical Trial): | |
| Antigen | |
| Antigen: | MP18 RNA editing complex protein |
| Antigen mutation: | No |
| Durg Target: | |
Antibody
Chain: A
Mutation: NULL
| >3K7U_A|Chain A|Antibody|Lama glama (9844) QVQLQESGGGLVQAGGSLTLSCAASGRTFSNNAMGWFRQAPGKEREFVAAISWTGGLLFYADSVNGRFTISRDNAKRTVTLQMNSLKPEDTAVYYCAARPQGDYVTAHYDYWGQGTQVTVSSHHHHHH |
Antigen
Chain: C
Mutation: NULL
| >3K7U_C|Chain B[auth C]|MP18 RNA editing complex protein|Trypanosoma brucei (5691) GMSKSVNSVTLVGVVHDIQSGFVYEDAVTQFTLTTTSIDTTHPTQEVVVEKDHHTIRCFGELFSAEVKQKVKEGNVVCVNGRLRLSPQLEPSCNKHFYFPYIQVQPPHGQVAVIHGDRRTVPAAVNPAVEDIKSEKEGSGGDQSGVPS |
Interaction
1、Solvent accessible surface areas (SASA) were calculated (Naccess V2.1.1) for each residue in antibody and antigen, respectively. The residues with SASA loss in binding of more than 1Å2 were classified as interacting residues.
Interacting residues (ΔSASA based)
| Chain residues position delta_SASA
: residuesposition A: PHE47 SER52 TRP53 THR54 GLY55 GLY56 LEU57 LEU58 PHE59 TYR60 ALA61 ASP62 ASN65 GLY102 ASP103 TYR104 VAL105 C: LEU78 PHE79 GLU82 VAL83 LYS86 VAL87 LYS88 PRO122 GLN126 VAL127 ALA128 VAL129 ILE130 HIS131 GLY132 ASP133 |
2、We defined interacting paratope-epitope residues by a distance cutoff of < 6 Å . Two amino acids are considered as interacting residues if they have at least one atom within a distance of 6 Å from any atom.
Interacting residues (Atom distance based)