| Complex | |
| AACDB_ID: | 313 |
| PDBID: | 2P43 |
| Chains: | B_A |
| Organism: | Bos taurus, Camelus dromedarius |
| Method: | XRD |
| Resolution (Å): | 1.65 |
| Reference: | 10.1110/ps.034892.108 |
| Antibody | |
| Antibody: | CAB-RN05 VHH |
| Antibody mutation: | No |
| INN (Clinical Trial): | |
| Antigen | |
| Antigen: | Ribonuclease pancreatic |
| Antigen mutation: | No |
| Durg Target: | |
Antibody
Chain: B
Mutation: NULL
| >2P43_B|Chain B|ANTIBODY CAB-RN05|Camelus dromedarius (9838) GSQVQLVESGGGLVQAGGSLRLSCAASGYAYTYIYMGWFRQAPGKEREGVAAMDSGGGGTLYADSVKGRFTISRDKGKNTVYLQMDSLKPEDTATYYCAAGGYELRDRTYGQWGQGTQVTVSS |
Antigen
Chain: A
Mutation: NULL
| >2P43_A|Chain A|Ribonuclease pancreatic|Bos taurus (9913) KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV |
Interaction
1、Solvent accessible surface areas (SASA) were calculated (Naccess V2.1.1) for each residue in antibody and antigen, respectively. The residues with SASA loss in binding of more than 1Å2 were classified as interacting residues.
Interacting residues (ΔSASA based)
| Chain residues position delta_SASA
: residuesposition B: TYR27 TYR29 THR30 TYR31 ILE32 TYR33 ARG45 GLY99 GLY100 TYR101 ARG104 ARG106 THR107 TYR108 GLY109 GLN110 TRP111 A: ALA4 CYS58 SER59 GLN60 LYS61 ASN62 VAL63 ALA64 GLY68 GLN69 THR70 ASN71 TYR73 TYR76 CYS110 GLU111 GLY112 ASN113 TYR115 VAL118 |
2、We defined interacting paratope-epitope residues by a distance cutoff of < 6 Å . Two amino acids are considered as interacting residues if they have at least one atom within a distance of 6 Å from any atom.
Interacting residues (Atom distance based)