Warning: file_get_contents(PDB_split/6IKM_i_I/6IKM_I.fasta): failed to open stream: No such file or directory in /home/hj/immunet/www/AACDB/details.php on line 117

Details

Structure visualisation

Display styles :





Display color :





Entry information

Complex
AACDB_ID: 2331
PDBID: 6IKM
Chains: i_I
Organism: Pseudomonas aeruginosa, Homo sapiens
Method: XRD
Resolution (Å): 3.40
Reference: 10.1016/j.jmb.2019.10.026
Antibody
Antibody: ScFv5 scFv
Antibody mutation: No
INN (Clinical Trial):
Antigen
Antigen: SpuE-Spermidine Polyamine transport protein
Antigen mutation: No
Durg Target:

Sequence information

Antibody

Chain: i
Mutation: NULL

>6IKM_I|Chain A, AA[auth B], C, CA[auth D], E, EA[auth F], G, GA[auth H], I, IA[auth J], K, M[auth L], O[auth M], Q[auth N], S[auth O], U[auth P], W[auth Q], Y[auth R]|Polyamine transport protein|Pseudomonas aeruginosa (287)
GPLGSSLHIYNWTDYIAPTTLKDFTKESGIDVSYDVFDSNETLEGKLVSGHSGYDIVVPSNNFLGKQIQAGAFQKLDKSKLPNWKNLDPALLKQLEVSDPGNQYAVPYLWGTNGIGYNVAKVKEVLGDQPIDSWAILFEPENMKKLAKCGVAFMDSGDEMLPAALNYLGLDPNTHDPKDYKKAEEVLTKVRPYVSYFHSSKYISDLANGNICVAFGYSGDVFQAAARAEEAGKGIDIQYVIPKEGANLWFDLMAIPADAKAADNAYAFIDYLLRPEVIAKVSDYVGYANAIPGARPLMDKSVSDSEEVYPPQAVLDKLYVSAVLPAKVLRLQTRTWTRIK

Antigen

Chain: I
Mutation: NULL


Interaction

1、Solvent accessible surface areas (SASA) were calculated (Naccess V2.1.1) for each residue in antibody and antigen, respectively. The residues with SASA loss in binding of more than 1Å2 were classified as interacting residues.

Interacting residues (ΔSASA based)

Chain residues position delta_SASA : residuesposition

i: SER33 TYR34 GLY35 TRP52 ASN54 PRO55 ASN56 ASN61 ASP101 LYS102 ARG103 SER159 GLY163 ARG164 ASN165 TYR166 ASP184 ASN185 LYS200 TRP225 SER227 SER228 ARG230 VAL232

I: PHE244 GLU251 GLN260 GLU298 GLY315 ARG317 PRO318 LEU319 MET320 ASP321 LYS322 SER323 SER325 ASP326 SER327 GLU328 GLU329 TYR331 PRO333

2、We defined interacting paratope-epitope residues by a distance cutoff of < 6 Å . Two amino acids are considered as interacting residues if they have at least one atom within a distance of 6 Å from any atom.

Interacting residues (Atom distance based)

Download

Download sequences
Download structure
Download interacting residues (ΔSASA based)
Download interacting residues (Distance based)