| Complex | |
| AACDB_ID: | 2052 |
| PDBID: | 6B3S |
| Chains: | CD_B |
| Organism: | Homo sapiens |
| Method: | XRD |
| Resolution (Å): | 2.80 |
| Reference: | 10.1158/1535-7163.MCT-17-0575 |
| Antibody | |
| Antibody: | Necitumumab Fab |
| Antibody mutation: | No |
| INN (Clinical Trial): | Necitumumab(Approved) |
| Antigen | |
| Antigen: | Epidermal growth factor receptor |
| Antigen mutation: | No |
| Durg Target: | Q504U8; P00533; |
Antibody
Heavy Chain: C
Mutation: NULL
| >6B3S_C|Chain B[auth C], E[auth F], H, K[auth J]|Necitumumab Fab Heavy chain|Homo sapiens (9606) QVQLQESGPGLVKPSQTLSLTCTVSGGSISSGDYYWSWIRQPPGKGLEWIGYIYYSGSTDYNPSLKSRVTMSVDTSKNQFSLKVNSVTAADTAVYYCARVSIFGVGTFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS |
Light Chain: D
Mutation: NULL
| >6B3S_D|Chain C[auth D], F[auth G], I[auth K], L|Necitumumab Fab Light chain|Homo sapiens (9606) EIVMTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCHQYGSTPLTFGGGTKAEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGA |
Antigen
Chain: B
Mutation: NULL
| >6B3S_B|Chain A, D[auth B], G[auth E], J[auth I]|Epidermal growth factor receptor|Homo sapiens (9606) LEEKKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIIRNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKHHHHHH |
Interaction
1、Solvent accessible surface areas (SASA) were calculated (Naccess V2.1.1) for each residue in antibody and antigen, respectively. The residues with SASA loss in binding of more than 1Å2 were classified as interacting residues.
Interacting residues (ΔSASA based)
| Chain residues position delta_SASA
: residuesposition C: GLY32 ASP33 TYR35 SER37 TYR52 TYR54 TYR55 SER56 SER58 THR59 ASP60 VAL100 ILE102 PHE103 GLY104 VAL105 GLY106 THR107 PHE108 D: GLN27 TYR32 ASP50 TYR91 GLY92 SER93 THR94 LEU96 B: LEU348 PRO349 LEU382 GLN384 ALA385 GLU388 GLN408 HIS409 GLN411 PHE412 ALA415 VAL417 SER418 ILE438 SER440 GLY441 LYS443 THR464 LYS465 ILE466 ILE467 ARG468 ASN469 ARG470 GLY471 ASN473 |
2、We defined interacting paratope-epitope residues by a distance cutoff of < 6 Å . Two amino acids are considered as interacting residues if they have at least one atom within a distance of 6 Å from any atom.
Interacting residues (Atom distance based)