| Complex | |
| AACDB_ID: | 1354 |
| PDBID: | 5FV1 |
| Chains: | M_W |
| Organism: | Homo sapiens |
| Method: | XRD |
| Resolution (Å): | 2.70 |
| Reference: | 10.1074/jbc.M115.691162 |
| Antibody | |
| Antibody: | 5FV1 VK-sdAb |
| Antibody mutation: | No |
| INN (Clinical Trial): | |
| Antigen | |
| Antigen: | Human Vascular Endothelial Growth Factor |
| Antigen mutation: | No |
| Durg Target: | P15692 |
Antibody
Chain: M
Mutation: NULL
| >5FV1_M|Chain A[auth L], B[auth M]|VK DOMAIN ANTIBODY|HOMO SAPIENS (9606) DIQMTQSPSSLSASVGDRVTITCRASQWIGPELKWYQQKPGKAPKLLIYHGSILQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYMYYPHTFGQGTKVEIKR |
Antigen
Chain: W
Mutation: NULL
| >5FV1_W|Chain C[auth V], D[auth W]|VASCULAR ENDOTHELIAL GROWTH FACTOR A|HOMO SAPIENS (9606) APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRHHHHHH |
Interaction
1、Solvent accessible surface areas (SASA) were calculated (Naccess V2.1.1) for each residue in antibody and antigen, respectively. The residues with SASA loss in binding of more than 1Å2 were classified as interacting residues.
Interacting residues (ΔSASA based)
| Chain residues position delta_SASA
: residuesposition M: TRP28 PRO31 GLU32 TYR49 HIS50 ILE53 LEU54 TYR91 MET92 TYR93 W: PHE17 MET18 TYR21 GLN22 TYR25 CYS61 ASN62 ASP63 LEU66 CYS104 ARG105 PRO106 |
2、We defined interacting paratope-epitope residues by a distance cutoff of < 6 Å . Two amino acids are considered as interacting residues if they have at least one atom within a distance of 6 Å from any atom.
Interacting residues (Atom distance based)