| Complex | |
| AACDB_ID: | 1009 |
| PDBID: | 4W2O |
| Chains: | G_H |
| Organism: | Lama glama, Marburg virus - Musoke, Kenya, 1980 |
| Method: | XRD |
| Resolution (Å): | 3.20 |
| Reference: | 10.3389/fimmu.2017.01234 |
| Antibody | |
| Antibody: | B VHH |
| Antibody mutation: | No |
| INN (Clinical Trial): | |
| Antigen | |
| Antigen: | Marburg virus (MARV) Nucleoprotein |
| Antigen mutation: | No |
| Durg Target: | |
Antibody
Chain: G
Mutation: NULL
| >4W2O_G|Chain A, C, E, G|Anti-Marburgvirus Nucleoprotein Single Domain Antibody B|Lama glama (9844) KVQLQESGGGLVQAGGSLRLSCAASGGTFSINTLGWYRRAPGKEREFVARISSGGITRYADSVKGRFTISRDNGKNTVYLDMNSLKPEDTAVYYCMYRNWGGGLDVYWGQGTQVTVSSGGHHHHHH |
Antigen
Chain: H
Mutation: NULL
| >4W2O_H|Chain B, D, F, H|Nucleoprotein|Lake Victoria marburgvirus (strain Musoke-80) (33727) MGHHHHHHGGGSSPSAPQEDTRMREAYELSPDFTNDEDNQQNWPQRVVTKKGRTFLYPNDLLQTNPPESLITALVEEYQNPVSAKELQADWPDMSFDERRHVAMNL |
Interaction
1、Solvent accessible surface areas (SASA) were calculated (Naccess V2.1.1) for each residue in antibody and antigen, respectively. The residues with SASA loss in binding of more than 1Å2 were classified as interacting residues.
Interacting residues (ΔSASA based)
| Chain residues position delta_SASA
: residuesposition G: THR28 SER30 ILE31 ASN32 THR33 ARG50 SER52 SER53 GLY54 ILE56 ARG58 ARG98 ASN99 TRP100 GLY101 GLY102 GLY103 LEU104 H: LEU663 TYR667 ASN669 SER672 GLU675 LEU676 ALA678 ASP679 ASP682 MET683 SER684 ASP686 GLU687 HIS690 VAL691 ASN694 LEU695 |
2、We defined interacting paratope-epitope residues by a distance cutoff of < 6 Å . Two amino acids are considered as interacting residues if they have at least one atom within a distance of 6 Å from any atom.
Interacting residues (Atom distance based)