| General information | |
| ACovPid: | ACoVP100490 |
| Trivial Name: | MERS-CoV HRC |
| Amino Acids Sequence: | SLTQINTTLLDLTYEMLSLQQVVKALNESYIDLKEL |
| Length: | 36 |
| C-Terminal Modification: | None |
| N-Terminal Modification: | None |
| Chemical Modification: | None |
| Peptide Source: | The Middle East respiratory syndrome coronavirus (MERS-CoV) : |
| Source Description: | |
| Against Virus: | |
| Inhibition Value Type: | IC50 |
| Inhibitory Effect: | ~0.004 |
| Inhibitory Unit: | µM |
| Target Domain Name: | |
| Assay: | Plaque reduction assay |
| Assay Description: | Titers of virus stocks were determined by plaque assay in Vero E6 cells grown in six-well tissue culture plates. Virus stocks were serially diluted 10-fold in PBS, and 0.2 ml of each dilution was inoculated into quadruplicate wells and allowed to adsorb at 37°C for 1 h with rocking every 15 min. Monolayers were rinsed with Dulbecco’s phosphate-buffered saline (DPBS; Corning) and then overlaid with a semisolid medium containing MEM, 5% FBS, antibiotics, and ME agarose (0.6%). Cultures were incubated at 37°C for 3 days and overlaid with DPBS containing neutral red (3.33 g/liter; Thermo Fisher Scientific) as a stain (10%), and plaques were counted after 4 to 5 h. Peptides were tested for inhibitory activity against SARS-CoV-2 and MERS-CoV by plaque reduction neutralization assay. Peptides were serially diluted in molecular biology grade water (10,000 nM through 5 nM or 1,000 nM through 0.5 nM), each peptide dose was mixed with an equal volume of virus containing 500 particle-forming units (PFU)/ml in MEM, and the peptide/virus mixtures were incubated at 37°C for 1 h. Each peptide dose/virus mixture was inoculated into triplicate wells of Vero E6 cells in six-well plates (0.2 ml per well) and allowed to adsorb at 37°C for 1 h with rocking every 15 min. Monolayers were rinsed with DPBS prior to the addition of medium overlay containing MEM, 5% FBS, antibiotics, and ME agarose (0.6%). Cultures were incubated at 37°C for 3 days and overlaid with medium containing neutral red as a stain, and plaques were counted after 4 to 5 h. Virus controls were mixed with sterile water instead of peptide. |
| Anti-CoV activity in vivo: | |
| Reference: | 33082259 |
| Comment: | |
| 3D structure: | |
| Structure Experiment Verified: | NO |
| Similar Peptides: | ACoVP100141   ACoVP100116   ACoVP100139   ACoVP100140   ACoVP100178 |