General information
    ACovPid:ACoVP100483
    Trivial Name:MERS-CoV HRC
    Amino Acids Sequence:SLTQINTTLLDLTYEMLSLQQVVKALNESYIDLKEL
    Length:36
    C-Terminal Modification:None
    N-Terminal Modification:None
    Chemical Modification:None
    Peptide Source:

    The Middle East respiratory syndrome coronavirus (MERS-CoV) :

    Source Description:
    Against Virus:

    Severe acute respiratory syndrome coronavirus (SARS-CoV) : 694009

    Inhibition Value Type:IC50
    Inhibitory Effect:0.04 ± 0.034
    Inhibitory Unit:µM
    Target Domain Name:
    Assay:β-Gal complementation-based fusion assay.
    Assay Description:The author previously adapted a fusion assay based on alpha complementation of β-galactosidase (β-Gal). The assay is based on alpha complementation of beta-gal; the beta-gal protein lacking the N-terminal 85 residues (omega peptide) is expressed from one plasmid, and the N-terminal 85 residues (alpha peptide) is expressed from a second plasmid. Cell fusion leads to complementation, and beta-galactosidase is quantitated using the Galacto-Star (Applied Biosystems) chemiluminescent reporter gene assay system. Receptor bearing cells expressing the omega peptide are mixed with viral glycoproteins co-expressing cells that also express the alpha peptide, at various temperatures and at specific time points. Fusion is stopped by lysing the cells with lysis buffer. In this assay, hACE2 or DDP4 receptor-bearing cells expressing the omega peptide of β-Gal are mixed with cells coexpressing glycoprotein S and the alpha peptide of β-Gal, and cell fusion leads to alpha-omega complementation. Fusion is stopped by lysing the cells, and after addition of the substrate (Tropix Galacto-Star chemiluminescent reporter assay system; Applied Biosystem), luminescence is quantified on a Tecan M1000PRO microplate reader.
    Anti-CoV activity in vivo:
    Reference:33082259
    Comment:
    3D structure:

    StructureACoVP100483

    Structure Experiment Verified:NO
    Similar Peptides:ACoVP100141   ACoVP100116   ACoVP100139   ACoVP100140   ACoVP100178