General information | |
ACovPid: | ACoVP100433 |
Trivial Name: | 5 |
Amino Acids Sequence: | IEEQAKTFLDKFNHEKEDLEYQSSLASWNYNTNIT |
Length: | 35 |
C-Terminal Modification: | None |
N-Terminal Modification: | None |
Chemical Modification: | None |
Peptide Source: | Human Angiotensin Converting Enzyme 2 (hACE2) : 9606 |
Source Description: | Stapledpeptides 5 were synthesised using SPPS, followed by staplingof the side-chains with lactam-basedi,i+ 4 methods, andcleavage of the stapled hACE2 peptides from the resin ( |
Against Virus: | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) : 2697049 |
Inhibition Value Type: | IC50 |
Inhibitory Effect: | 3.6 |
Inhibitory Unit: | µM |
Target Domain Name: | RBD of SARS-CoV-2 |
Assay: | Inhibitor Screening Assays SARS-CoV-2 Spike/hACE2 Inhibitor Screening Assays |
Assay Description: | The panel of stapled hACE2 N-terminal α1-helix peptides was screened for inhibition of the SARS-CoV-2 Spike/hACE2 complex formation using the commercially available SARS-CoV-2 Spike Inhibitor Screening Assay Kit (BPS Bioscience, Cat. Number #79931, San Diego, CA, USA) following the manufacturer’s instructions. All peptides were screened for inhibition at a single concentration (10 µM) in PBS, before screening active peptides in a range of concentrations (0.3 µM - 300 µM) for IC50 determination. Additionally, a concentration-response curve of SARS-CoV-2 Spike Protein (RBD) Recombinant Human Monoclonal Antibody (T01KHu, Thermo Fischer Scientific, Cat. Number #703958) in PBS was made as a positive control for inhibition (0.6 nM - 200 µM). SARS-CoV-2 Spike protein (RBD), mFc Tag was thawed on ice and subsequently diluted to 1 µg/mL in PBS. Each well of a 96-well white microplate was filled with 50 µL of the diluted Spike solution and was incubated overnight at 4 °C. The microplate was washed three times with 1x Immuno Buffer 1 before blocking the wells with 100 µL Blocking Buffer 2 for 1 h at room temperature with slow shaking. The microplate was washed three times with 1x Immuno Buffer 1 and supernatant was removed. 20 µL of 1x Immuno Buffer 1 was added to each well. 10 µL of the inhibitor solution was added to each designated well, and 10 µL of PBS was added to wells designated as “positive control” and “blank” before incubating for 1 h at room temperature with slow shaking. Incubation was followed by the addition of 20 µL thawed ACE2-His (2.5 ng/uL, 30 nM) to each well except for “blank”. An additional 20 µL of 1x Immuno Buffer 1 was added to “blank” instead. The reaction was incubated for 1 h at room temperature with slow shaking before the microplate was washed three times with 1x Immuno Buffer 1. The wells were blocked with 100 µL Blocking Buffer 2 for 10 min at room temperature with slow shaking and were washed three times with 1x Immuno Buffer 1 afterwards. Anti-His-HRP was diluted 1000x in 1x Immuno Buffer 1 and 100 µL was added to each well to incubate for 1 h at room temperature with slow shaking. The wells were blocked with 100 µL Blocking Buffer 2 for 10 min at room temperature with slow shaking after 3 washes with 1x Immuno Buffer 1. The supernatant was decanted, and the wells were dried by tapping the microplate onto clean paper towels. Elisa ECL substrate A and B were mixed 1:1, and 100 uL of the substrate mixture was added to each well before measuring chemiluminescence using a FluoStar Omaga microplate reader (Ramcon A/S, Birkerød, Denmark). Data was normalized to luminescence values for the negative control and the curves were fitted with the variable slope non-linear regression. |
Anti-CoV activity in vivo: | |
Reference: | 33651072 |
Comment: | |
3D structure: | |
Structure Experiment Verified: | NO |
Similar Peptides: | ACoVP100429   ACoVP100150   ACoVP100431   ACoVP100432   ACoVP100495 |
Target Domain information | |
Target Domain Full Name: | Receptor-binding domain (RBD) of Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) spike glycoprotein |
Target Type: | glycoprotein |
UniprotID [Sequence]: | P0DTC2 [319-541] |
Target Synonyms: | Alternative name(s) for spike glycoprotein: E2 Peplomer protein S glycoprotein |
Target Source: | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) : 2697049 |
Target Structure: | 6LVN, 6LXT, 6LZG, 6M0J, 6M17, 6M1V, 6VSB, 6VW1, 6VXX, 6VYB, 6W41, 6WPS, 6WPT, 6X29, 6X2A, 6X2B, 6X2C, 6X6P, 6X79, 6XC2, 6XC3, 6XC4, 6XC7, 6XCM, 6XCN, 6XDG, 6XE1, 6XEY, 6XF5, 6XF6, 6XKL, 6XKP, 6XKQ, 6XLU, 6XM0, 6XM3, 6XM4, 6XM5, 6XR8, 6XRA, 6XS6, 6YLA, 6YM0, 6YOR, 6YZ5, 6YZ7, 6Z2M, 6Z43, 6Z97, 6ZB4, 6ZB5, 6ZBP, 6ZCZ, 6ZDG, 6ZDH, 6ZER, 6ZFO, 6ZGE, 6ZGG, 6ZGI, 6ZH9, 6ZHD, 6ZLR, 6ZOW, 6ZOX, 6ZOY, 6ZOZ, 6ZP0, 6ZP1, 6ZP2, 6ZP5, 6ZP7, 6ZWV, 6ZXN, 7A25, 7A29, 7A4N, 7A5R, 7A5S, 7A91, 7A92, 7A93, 7A94, 7A95, 7A96, 7A97, 7A98, 7AD1, 7BWJ, 7BYR, 7BZ5, 7C01, 7C2L, 7C8D, 7C8V, 7C8W, 7CAB, 7CAH, 7CAI, 7CAK, 7CAN, 7CDI, 7CDJ, 7CH4, 7CH5, 7CHB, 7CHC, 7CHE, 7CHF, 7CHH, 7CJF, 7CN9, 7CT5, 7CWM, 7CWN, 7CWO, 7CWS, 7CWU, 7DCC, 7DCX, 7DD2, 7DD8, 7DDD, 7DDN, 7DF3, 7DF4, 7DK3, 7DK4, 7DK5, 7DK6, 7DK7, 7DMU, 7JJC, 7JJI, 7JJJ, 7JMO, 7JMP, 7JMW, 7JV2, 7JV4, 7JV6, 7JVA, 7JVB, 7JVC, 7JW0, 7JWB, 7JWY, 7JX3, 7JZL, 7JZM, 7JZN, 7JZU, 7K43, 7K45, 7K4N, 7K8M, 7K8S, 7K8T, 7K8U, 7K8V, 7K8W, 7K8X, 7K8Y, 7K8Z, 7K90, 7K9Z, 7KDG, 7KDH, 7KDI, 7KDJ, 7KDK, 7KDL, 7KE4, 7KE6, 7KE7, 7KE8, 7KE9, 7KEA, 7KEB, 7KEC, 7KJ2, 7KJ3, 7KJ4, 7KJ5, 7KKK, 7KKL, 7KL9, 7KMB, 7KMS, 7KMZ, 7KNB, 7KNE, 7KNH, 7KNI, 7L02, 7L06, 7L09 |