General information
    ACovPid:ACoVP100150
    Trivial Name:P5
    Amino Acids Sequence:EEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEE
    Length:36
    C-Terminal Modification:None
    N-Terminal Modification:None
    Chemical Modification:None
    Peptide Source:

    Human Angiotensin Converting Enzyme 2 (hACE2) : 9606

    Source Description:ACE2-derived peptidesthat bind S glycoprotein with high affinity
    Against Virus:

    Severe acute respiratory syndrome coronavirus (SARS-CoV) : 694009

    Inhibition Value Type:IC50
    Inhibitory Effect:6
    Inhibitory Unit:µM
    Target Domain Name:RBD of SARS-CoV
    Assay:
    Assay Description:To evaluate antiviral activity, pseudoviruses (SARS-S orVSV-G) were preincubated with indicated concentrations ofpeptides for 20 min at 37 °C. Subsequently, the virus–peptidemixture was added to VeroE6 cells or HeLa cells transfectedwith a plasmid encoding the wild type ACE2. After a 20-minadsorption period, the virus inoculum was removed and freshculture medium was added. Following additional 1.5 days ofinfection, infected cells were stained and virus-infected cellswere quantified as described above.
    Anti-CoV activity in vivo:
    Reference:16510163
    Comment:
    3D structure:

    StructureACoVP100150

    Structure Experiment Verified:NO
    Similar Peptides:ACoVP100429   ACoVP100430   ACoVP100431   ACoVP100432   ACoVP100495

    Target Domain information
    Target Domain Full Name:Receptor-binding domain (RBD) of Severe acute respiratory syndrome coronavirus (SARS-CoV) spike glycoprotein
    Target Type:glycoprotein
    UniprotID [Sequence]:

    P59594 [306–527]

    Target Synonyms:Alternative name(s) for spike glycoprotein: E2 Peplomer protein S glycoprotein
    Target Source:

    Severe acute respiratory syndrome coronavirus (SARS-CoV) : 694009

    Target Structure:1WNC, 1WYY, 1ZV7, 1ZV8, 1ZVB, 2AJF, 2BEQ, 2BEZ, 2DD8, 2FXP, 2GHV, 2GHW, 2RUM, 2RUN, 2RUO, 3BGF, 3D0G, 3D0H, 3D0I, 3SCI, 3SCJ, 3SCK, 3SCL, 5WRG, 5X4S, 5X58, 5X5B, 5XJK, 5XLR, 5ZVM, 6ACC, 6ACD, 6ACG, 6ACJ, 6ACK, 6CRV, 6CRW, 6CRX, 6CRZ, 6CS0, 6CS1, 6CS2, 6M3W, 6NB6, 6NB7, 6VW1, 6WAQ, 7JN5