General information | |
ACovPid: | ACoVP100397 |
Trivial Name: | P8 |
Amino Acids Sequence: | SALEEQLKTFLDKFMHELEDLLYQLAL-NH2 |
Length: | |
C-Terminal Modification: | NH2: Amide;   |
N-Terminal Modification: | None |
Chemical Modification: | None |
Peptide Source: | Human Angiotensin Converting Enzyme 2 (hACE2) : 9606 |
Source Description: | A series of peptides mimicking the N-terminal helix of hACE2 protein |
Against Virus: | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) : 2697049 |
Inhibition Value Type: | IC50 |
Inhibitory Effect: | 0.046 |
Inhibitory Unit: | µM |
Target Domain Name: | RBD of SARS-CoV-2 |
Assay: | Plaque reduction assay |
Assay Description: | Vero-E6 or Calu-3 (1 × 10^5 cells mL−1) were seeded into 24 wells plates in infectious media and treated with different concentrations of the peptides (from 0.1 to 10 µM). After 30 min at room temperature, cells were infected with 0.1 multiplicity of infection (MOI) (Vero-E6) or 0.3 MOI (Calu-3) of SRAS-CoV-2 (SARS-CoV-2/PSL2020 P#2 stock) in infectious media. Cell supernatants were collected at 48 h post-infection for enzyme-linked immunosorbent assay (ELISA) assay using a SARS-CoV-2 (2019-nCoV) nucleoprotein ELISA kit (Sino biological), according the manufacturer’s instructions, and standard plaque assay (PMID: 32475066). Inhibition of infection was calculated comparing viral concentration in each case with that of untreated SARS- CoV-2-infected cells. |
Anti-CoV activity in vivo: | |
Reference: | 33580154 |
Comment: | |
3D structure: | |
Structure Experiment Verified: | |
Similar Peptides: | ACoVP100399   ACoVP100398   ACoVP100429   ACoVP100495   ACoVP100150 |
Target Domain information | |
Target Domain Full Name: | Receptor-binding domain (RBD) of Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) spike glycoprotein |
Target Type: | glycoprotein |
UniprotID [Sequence]: | P0DTC2 [319-541] |
Target Synonyms: | Alternative name(s) for spike glycoprotein: E2 Peplomer protein S glycoprotein |
Target Source: | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) : 2697049 |
Target Structure: | 6LVN, 6LXT, 6LZG, 6M0J, 6M17, 6M1V, 6VSB, 6VW1, 6VXX, 6VYB, 6W41, 6WPS, 6WPT, 6X29, 6X2A, 6X2B, 6X2C, 6X6P, 6X79, 6XC2, 6XC3, 6XC4, 6XC7, 6XCM, 6XCN, 6XDG, 6XE1, 6XEY, 6XF5, 6XF6, 6XKL, 6XKP, 6XKQ, 6XLU, 6XM0, 6XM3, 6XM4, 6XM5, 6XR8, 6XRA, 6XS6, 6YLA, 6YM0, 6YOR, 6YZ5, 6YZ7, 6Z2M, 6Z43, 6Z97, 6ZB4, 6ZB5, 6ZBP, 6ZCZ, 6ZDG, 6ZDH, 6ZER, 6ZFO, 6ZGE, 6ZGG, 6ZGI, 6ZH9, 6ZHD, 6ZLR, 6ZOW, 6ZOX, 6ZOY, 6ZOZ, 6ZP0, 6ZP1, 6ZP2, 6ZP5, 6ZP7, 6ZWV, 6ZXN, 7A25, 7A29, 7A4N, 7A5R, 7A5S, 7A91, 7A92, 7A93, 7A94, 7A95, 7A96, 7A97, 7A98, 7AD1, 7BWJ, 7BYR, 7BZ5, 7C01, 7C2L, 7C8D, 7C8V, 7C8W, 7CAB, 7CAH, 7CAI, 7CAK, 7CAN, 7CDI, 7CDJ, 7CH4, 7CH5, 7CHB, 7CHC, 7CHE, 7CHF, 7CHH, 7CJF, 7CN9, 7CT5, 7CWM, 7CWN, 7CWO, 7CWS, 7CWU, 7DCC, 7DCX, 7DD2, 7DD8, 7DDD, 7DDN, 7DF3, 7DF4, 7DK3, 7DK4, 7DK5, 7DK6, 7DK7, 7DMU, 7JJC, 7JJI, 7JJJ, 7JMO, 7JMP, 7JMW, 7JV2, 7JV4, 7JV6, 7JVA, 7JVB, 7JVC, 7JW0, 7JWB, 7JWY, 7JX3, 7JZL, 7JZM, 7JZN, 7JZU, 7K43, 7K45, 7K4N, 7K8M, 7K8S, 7K8T, 7K8U, 7K8V, 7K8W, 7K8X, 7K8Y, 7K8Z, 7K90, 7K9Z, 7KDG, 7KDH, 7KDI, 7KDJ, 7KDK, 7KDL, 7KE4, 7KE6, 7KE7, 7KE8, 7KE9, 7KEA, 7KEB, 7KEC, 7KJ2, 7KJ3, 7KJ4, 7KJ5, 7KKK, 7KKL, 7KL9, 7KMB, 7KMS, 7KMZ, 7KNB, 7KNE, 7KNH, 7KNI, 7L02, 7L06, 7L09 |