General information
    ACovPid:ACoVP100255
    Trivial Name:HR1-1
    Amino Acids Sequence:NGIGVTQNVLYENQKQIANQFNKAISQIQESLTTTSTA
    Length:38
    C-Terminal Modification:None
    N-Terminal Modification:None
    Chemical Modification:None
    Peptide Source:

    Severe acute respiratory syndrome coronavirus (SARS-CoV) : 694009

    Source Description:From the heptad repeat region 1 of spike glycoprotein of SARS-CoV
    Against Virus:

    Severe acute respiratory syndrome coronavirus (SARS-CoV) : 694009

    Inhibition Value Type:EC50
    Inhibitory Effect:3.68
    Inhibitory Unit:µM
    Target Domain Name:HR2 domain of SARS-CoV
    Assay:MTT assay
    Assay Description:BJ01 strain (SARS-CoV wild-type virus) was a gift of Beijing Genomics Institute. Two hundred TCID50 of wild-type SARS-CoV were co-incubated with 50 µl peptides of different concentrations at 37 °C for 30 min. The mixture was then transferred to 96-well plates, eight wells for each dilution. After incubation for 60 h, a MTT assay was then performed as described previously(PMID: 8450240). Briefly, 10 µl dimethylthiazol diphenyltetrazolium (MTT) (5 mg/ml) (Sigma–Aldrich) was added to each well and incubated for 4 h. The medium in each well was then replaced with 100 µl DMSO and the plates stayed at room temperature for 10 min for color development before being read by a BioRad Model 550 ELISA reader (using a test wavelength of 570 nm and a reference wavelength of 630 nm).
    Anti-CoV activity in vivo:
    Reference:15184046
    Comment:
    3D structure:

    StructureACoVP100255

    Structure Experiment Verified:NO
    Similar Peptides:ACoVP100129   ACoVP100219   ACoVP100260   ACoVP100258   ACoVP100130

    Target Domain information
    Target Domain Full Name:Heptad repeat 2 (HR2) domain of Severe acute respiratory syndrome coronavirus (SARS-CoV) spike glycoprotein
    Target Type:glycoprotein
    UniprotID [Sequence]:

    P59594 [1145-1184]

    Target Synonyms:Alternative name(s) for spike glycoprotein: E2 Peplomer protein S glycoprotein
    Target Source:

    Severe acute respiratory syndrome coronavirus (SARS-CoV) : 694009

    Target Structure:1WNC, 1WYY, 1ZV7, 1ZV8, 1ZVB, 2AJF, 2BEQ, 2BEZ, 2DD8, 2FXP, 2GHV, 2GHW, 2RUM, 2RUN, 2RUO, 3BGF, 3D0G, 3D0H, 3D0I, 3SCI, 3SCJ, 3SCK, 3SCL, 5WRG, 5X4S, 5X58, 5X5B, 5XJK, 5XLR, 5ZVM, 6ACC, 6ACD, 6ACG, 6ACJ, 6ACK, 6CRV, 6CRW, 6CRX, 6CRZ, 6CS0, 6CS1, 6CS2, 6M3W, 6NB6, 6NB7, 6VW1, 6WAQ, 7JN5