General information
    ACovPid:ACoVP100234
    Trivial Name:HR1-5
    Amino Acids Sequence:YVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKG
    Length:40
    C-Terminal Modification:None
    N-Terminal Modification:None
    Chemical Modification:None
    Peptide Source:

    Severe acute respiratory syndrome coronavirus (SARS-CoV) : 694009

    Source Description:From the heptad repeat region 1 of spike glycoprotein of SARS-CoV
    Against Virus:

    Severe acute respiratory syndrome coronavirus (SARS-CoV) : 694009

    Inhibition Value Type:EC50
    Inhibitory Effect:
    Inhibitory Unit:
    Target Domain Name:HR2 domain of SARS-CoV
    Assay:Pseudotyped virus infection inhibition assay
    Assay Description:To produce HIV-luc/SARS pseudotyped virus, 10 µg of pNL-4-3E-R-Luc (HIV-luc) and 10 µg codon optimized SARS-CoV S protein expression plasmids pcTSh were co-transfected into 2 × 106 293T cells with calcium phosphate. The medium was replaced 16 h posttransfection. After further 48 h incubation, the supernatant containing the pseudotyped virus was collected and filtered through a 0.45 µm Millipore-sized membrane. For the inhibition assay, 0.5 ng of HIV-luc/SARS pseudotyped virus was incubated with serially diluted peptides at 37 °C for 30 min. The virus/peptide mixture was then transferred to 96-well plates seeded with Vero E6 cells (3 × 103 cells/well). Each concentration was tested in octuple. After overnight incubation, the medium was replaced and the sample was incubated for an additional 36 h. The cells were then lysed and luciferase activities were measured by a Wallac Mutilabel 1420 Counter (Perkin–Elmer) using the Luciferase Assay System (Promega).
    Anti-CoV activity in vivo:
    Reference:15184046
    Comment:
    3D structure:

    StructureACoVP100234

    Structure Experiment Verified:NO
    Similar Peptides:ACoVP100222   ACoVP100233   

    Target Domain information
    Target Domain Full Name:Heptad repeat 2 (HR2) domain of Severe acute respiratory syndrome coronavirus (SARS-CoV) spike glycoprotein
    Target Type:glycoprotein
    UniprotID [Sequence]:

    P59594 [1145-1184]

    Target Synonyms:Alternative name(s) for spike glycoprotein: E2 Peplomer protein S glycoprotein
    Target Source:

    Severe acute respiratory syndrome coronavirus (SARS-CoV) : 694009

    Target Structure:1WNC, 1WYY, 1ZV7, 1ZV8, 1ZVB, 2AJF, 2BEQ, 2BEZ, 2DD8, 2FXP, 2GHV, 2GHW, 2RUM, 2RUN, 2RUO, 3BGF, 3D0G, 3D0H, 3D0I, 3SCI, 3SCJ, 3SCK, 3SCL, 5WRG, 5X4S, 5X58, 5X5B, 5XJK, 5XLR, 5ZVM, 6ACC, 6ACD, 6ACG, 6ACJ, 6ACK, 6CRV, 6CRW, 6CRX, 6CRZ, 6CS0, 6CS1, 6CS2, 6M3W, 6NB6, 6NB7, 6VW1, 6WAQ, 7JN5