| General information | |
| ACovPid: | ACoVP100222 |
| Trivial Name: | NP-4 |
| Amino Acids Sequence: | GRLQSLQTYVTQQLIRAAEIRASANLAATKMSEC |
| Length: | 34 |
| C-Terminal Modification: | None |
| N-Terminal Modification: | None |
| Chemical Modification: | None |
| Peptide Source: | Severe acute respiratory syndrome coronavirus (SARS-CoV) : 694009 |
| Source Description: | From the heptad repeat 2 region of spike glycoprotein of SARS-CoV |
| Against Virus: | Severe acute respiratory syndrome coronavirus (SARS-CoV) : 694009 |
| Inhibition Value Type: | IC50 |
| Inhibitory Effect: | |
| Inhibitory Unit: | |
| Target Domain Name: | |
| Assay: | Cytopathic effect (CPE) inhibition assay |
| Assay Description: | The inhibitory activity of the synthetic peptides on SARS-CoV infection of Vero E6 cells was performed.was assessed as previously described(PMID: 32214698). 100 TCID50 (50% tissue-culture infectious dose) of SARS-CoV WHU strain (accession number AY394850) was mixed with an equal volume of a peptide at graded concentrations and incubated at 37°C for 30 min. The mixture was added to monolayers of Vero E6 cells in 96-well tissue-culture plates. After incubation at 37°C for 1 h, the supernatants were removed and fresh medium was added. On day 3 after infection, the cytopathic effect was recorded and the concentrations of the peptides resulting in 50% inhibition (IC50) were calculated. |
| Anti-CoV activity in vivo: | |
| Reference: | 15043961 |
| Comment: | |
| 3D structure: | |
| Structure Experiment Verified: | NO |
| Similar Peptides: | ACoVP100233 ACoVP100234 |