General information
    ACovPid:ACoVP100222
    Trivial Name:NP-4
    Amino Acids Sequence:GRLQSLQTYVTQQLIRAAEIRASANLAATKMSEC
    Length:34
    C-Terminal Modification:None
    N-Terminal Modification:None
    Chemical Modification:None
    Peptide Source:

    Severe acute respiratory syndrome coronavirus (SARS-CoV) : 694009

    Source Description:From the heptad repeat 2 region of spike glycoprotein of SARS-CoV
    Against Virus:

    Severe acute respiratory syndrome coronavirus (SARS-CoV) : 694009

    Inhibition Value Type:IC50
    Inhibitory Effect:
    Inhibitory Unit:
    Target Domain Name:
    Assay:Cytopathic effect (CPE) inhibition assay
    Assay Description:The inhibitory activity of the synthetic peptides on SARS-CoV infection of Vero E6 cells was performed.was assessed as previously described(PMID: 32214698). 100 TCID50 (50% tissue-culture infectious dose) of SARS-CoV WHU strain (accession number AY394850) was mixed with an equal volume of a peptide at graded concentrations and incubated at 37°C for 30 min. The mixture was added to monolayers of Vero E6 cells in 96-well tissue-culture plates. After incubation at 37°C for 1 h, the supernatants were removed and fresh medium was added. On day 3 after infection, the cytopathic effect was recorded and the concentrations of the peptides resulting in 50% inhibition (IC50) were calculated.
    Anti-CoV activity in vivo:
    Reference:15043961
    Comment:
    3D structure:

    StructureACoVP100222

    Structure Experiment Verified:NO
    Similar Peptides:ACoVP100233   ACoVP100234