General information
    ACovPid:ACoVP100192
    Trivial Name:MERS-HR2P
    Amino Acids Sequence:SLTQINTTLLDLTYEMLSLQQVVKALNESYIDLKEL
    Length:36
    C-Terminal Modification:None
    N-Terminal Modification:None
    Chemical Modification:None
    Peptide Source:

    Tylonycteris sp. Bat coronavirus HKU4 : 694007

    Source Description:This article use the piptide from Tylonycteris sp. Bat coronavirus HKU4, but the source article of Bat coronavirus HKU4 is 《SARS-like virus in the Middle East: A truly bat-related coronavirus causing human diseases》(PMID:23143870)
    Against Virus:

    The Middle East respiratory syndrome coronavirus (MERS-CoV)

    Inhibition Value Type:IC50
    Inhibitory Effect:1.14
    Inhibitory Unit:µM
    Target Domain Name:
    Assay:Pseudotyped virus infection inhibition assay
    Assay Description:The package of MERS-CoV pseudovirus was performed described in our previous studies (PMID: 24473083, 26164863). Briefly,we cotransfected 293T cells with plasmid pcDNA3.1-MERS-S with or without Q1020H/R mutationand plasmid pNL4-3.luc.R-E encoding Env-defective, luciferase-expressing HIV-1.Then,the pseudoviruses in the supernatant were collected 48–72 h post-transfection and quantified bythe level of lentivirus p24. Target cells, Huh-7, were preplated in 96-well plates (1×10^4cells per well).The MERS-CoV pseudovirus was premixed with peptide at indicated concentration and incubated for30 min at 37◦C. PBS was used as no inhibition control. Then, the mixture was added to the Huh-7 cells,replaced by fresh medium 12 h post-infection, and then incubated for an additional 48 h. TransducedHuh-7 cells were lysed for detection of relative light units (RLU) according to the luciferase assaysystem manual (Promega, Madison, WI, USA)
    Anti-CoV activity in vivo:
    Reference:30646495
    Comment:The source of Q1020/Q1020H/Q1020R : Huh-7 and 293T cells were obtained from the Chinese Academy of Sciences Cell Bank (Shanghai,China). All cell lines were cultured in Dulbecco’s Modified Eagle’s Medium (DMEM) with 10%fetal bovine serum (FBS). Plasmids, including pcDNA3.1-MERS-S, pcDNA3.1-MERS-S with Q1020Hor Q1020R mutation, pAAV-IRES-S-GFP and pNL4-3.Luc.R-E, were constructed in our laboratory.All peptides were synthesized by KareBay Biochem (Monmouth Junction, NJ, USA) with HPLCpurity >90% [21,22]. The average hydrophilicity of peptides was predicted by using an onlinepeptide-calculator program (available online: http://www.bachem.com/service-support/peptide-calculator/).
    3D structure:

    StructureACoVP100192

    Structure Experiment Verified:NO
    Similar Peptides:ACoVP100141   ACoVP100116   ACoVP100139   ACoVP100140   ACoVP100178