General information
    ACovPid:ACoVP100138
    Trivial Name:HR2P
    Amino Acids Sequence:SLTQINTTLLDLTYEMLSLQQVVKALNESYIDLKEL
    Length:36
    C-Terminal Modification:None
    N-Terminal Modification:None
    Chemical Modification:None
    Peptide Source:

    Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) (MERS-CoV) (Betacoronavirus England 1) : 1263720

    Source Description:
    Against Virus:

    Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) (MERS-CoV) (Betacoronavirus England 1) : 1263720

    Inhibition Value Type:IC50
    Inhibitory Effect:0.93 ± 0.15
    Inhibitory Unit:µM
    Target Domain Name:HR1 domain of SARS-CoV-2
    Assay:
    Assay Description:MERS-CoV S protein-mediated cell–cell fusion was assessed using a method similar to that for determining HIV-1 Env-mediated cell–cell fusion. Briefly, 293T cells were transfected with the plasmid pAAV-IRES-EGFP encoding the EGFP (293T/EGFP) or pAAV-IRES-MERS-EGFP encoding the MERS-CoV S protein and EGFP (293T/MERS/EGFP) and cultured in DMEM containing 10% FBS at 37°C for 48 h. Huh-7 cells (5 x 10^4) expressing the MERS-CoV receptor DPP4 were incubated in 96-well plates at 37°C for 5 h, followed by the addition of 1 x 10^4 293T/EGFP or 293T/MERS/EGFP cells, respectively, in the absence or presence of the test peptides at graded indicated concentrations. After co-culture at 37°C for 4 h, the 293T/MERS/EGFP cells (293T/EGFP cells were used as the negative control) fused or unfused with Huh-7 cells were counted under an inverted fluorescence microscope (Nikon Eclipse Ti-S). The fused cell was much larger by at least twofold than the unfused cell, and the intensity of fluorescence in the fused cell was weaker than that of the unfused cell as a result of the diffusion of EGFP from one cell to two or more cells (see Fig. 5a). The percent inhibition of cell–cell fusion was calculated using the following formula: (1 - (E - N)/(P - N)) x 100. ‘E’ represents the % cell–cell fusion in the experimental group. ‘P’ represents the % cell–cell fusion in the positive control group, to which no inhibitor was added. ‘N’ is the % cell–cell fusion in negative control group, in which 293T/MERS/EGFP cells were replaced by 293T/EGFP cells. The concentration for 50% inhibition (IC50) was calculated using the CalcuSyn software kindly provided by Dr T.C. Chou. After further co-culture at 37°C for 48 h, syncytium formation between 293T/MERS/EGFP and Huh-7 could be observed under an inverted microscope with or without fluorescence (Fig. 5b), and the syncytia were photographed for the record.
    Anti-CoV activity in vivo:
    Reference:24473083
    Comment:
    3D structure:

    StructureACoVP100138

    Structure Experiment Verified:NO
    Similar Peptides:ACoVP100141   ACoVP100116   ACoVP100139   ACoVP100140   ACoVP100178

    Target Domain information
    Target Domain Full Name:Heptad repeat 1 (HR1) domain of Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) spike glycoprotein
    Target Type:glycoprotein
    UniprotID [Sequence]:

    P0DTC2 [920-970]

    Target Synonyms:Alternative name(s) for spike glycoprotein: E2 Peplomer protein S glycoprotein
    Target Source:

    Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) : 2697049

    Target Structure:6LVN, 6LXT, 6LZG, 6M0J, 6M17, 6M1V, 6VSB, 6VW1, 6VXX, 6VYB, 6W41, 6WPS, 6WPT, 6X29, 6X2A, 6X2B, 6X2C, 6X6P, 6X79, 6XC2, 6XC3, 6XC4, 6XC7, 6XCM, 6XCN, 6XDG, 6XE1, 6XEY, 6XF5, 6XF6, 6XKL, 6XKP, 6XKQ, 6XLU, 6XM0, 6XM3, 6XM4, 6XM5, 6XR8, 6XRA, 6XS6, 6YLA, 6YM0, 6YOR, 6YZ5, 6YZ7, 6Z2M, 6Z43, 6Z97, 6ZB4, 6ZB5, 6ZBP, 6ZCZ, 6ZDG, 6ZDH, 6ZER, 6ZFO, 6ZGE, 6ZGG, 6ZGI, 6ZH9, 6ZHD, 6ZLR, 6ZOW, 6ZOX, 6ZOY, 6ZOZ, 6ZP0, 6ZP1, 6ZP2, 6ZP5, 6ZP7, 6ZWV, 6ZXN, 7A25, 7A29, 7A4N, 7A5R, 7A5S, 7A91, 7A92, 7A93, 7A94, 7A95, 7A96, 7A97, 7A98, 7AD1, 7BWJ, 7BYR, 7BZ5, 7C01, 7C2L, 7C8D, 7C8V, 7C8W, 7CAB, 7CAH, 7CAI, 7CAK, 7CAN, 7CDI, 7CDJ, 7CH4, 7CH5, 7CHB, 7CHC, 7CHE, 7CHF, 7CHH, 7CJF, 7CN9, 7CT5, 7CWM, 7CWN, 7CWO, 7CWS, 7CWU, 7DCC, 7DCX, 7DD2, 7DD8, 7DDD, 7DDN, 7DF3, 7DF4, 7DK3, 7DK4, 7DK5, 7DK6, 7DK7, 7DMU, 7JJC, 7JJI, 7JJJ, 7JMO, 7JMP, 7JMW, 7JV2, 7JV4, 7JV6, 7JVA, 7JVB, 7JVC, 7JW0, 7JWB, 7JWY, 7JX3, 7JZL, 7JZM, 7JZN, 7JZU, 7K43, 7K45, 7K4N, 7K8M, 7K8S, 7K8T, 7K8U, 7K8V, 7K8W, 7K8X, 7K8Y, 7K8Z, 7K90, 7K9Z, 7KDG, 7KDH, 7KDI, 7KDJ, 7KDK, 7KDL, 7KE4, 7KE6, 7KE7, 7KE8, 7KE9, 7KEA, 7KEB, 7KEC, 7KJ2, 7KJ3, 7KJ4, 7KJ5, 7KKK, 7KKL, 7KL9, 7KMB, 7KMS, 7KMZ, 7KNB, 7KNE, 7KNH, 7KNI, 7L02, 7L06, 7L09