General information
    ACovPid:ACoVP100091
    Trivial Name:OC43-HR2P
    Amino Acids Sequence:SLDYINVTFLDLQDEMNRLQEAIKVLNQSYINLKDI
    Length:36
    C-Terminal Modification:None
    N-Terminal Modification:None
    Chemical Modification:None
    Peptide Source:

    Human coronavirus OC43 (HCoV-OC43) : 31631

    Source Description:Peptide OC43-HR2P was derived from the HR2 domain of HCoV-OC43.
    Against Virus:

    Human coronavirus OC43 (HCoV-OC43) : 31631

    Inhibition Value Type:IC50
    Inhibitory Effect:0.52 ± 0.10
    Inhibitory Unit:µM
    Target Domain Name:HR1 domain of HCoV-OC43
    Assay:Cell-cell fusion
    Assay Description:The inhibitory activity of a test peptide on HCoV S-mediated cell-cell fusion was determined. Briefly, effector cells (293 T/S/GFP) and target cells (Huh-7 cells) were cocultured in the presence or absence of a test peptide at the indicated concentrations for fusion. After counting the fused and unfused cells, the percentage of cell-cell fusion was calculated, as described above. The percent inhibition of cell-cell fusion was calculated using the following formula as described : [1 − (E − N)/(P − N)] × 100%. “E” represents the percentage of cell-cell fusion in the experimental group. “P” represents the percentage of cell-cell fusion in the positive control group, where 293 T/HCoV S/EGFP cells were used as effector cells, to which only PBS was added. “N” is the percentage of cell-cell fusion in negative control group, where 293 T/EGFP cells were used as effector cells. The IC50 was calculated using the CalcuSyn software provided by T. C. Chou. Samples were tested in triplicate, and all those experiments were repeated twice.
    Anti-CoV activity in vivo:
    Reference:30989115
    Comment:
    3D structure:

    StructureACoVP100091

    Structure Experiment Verified:NO
    Similar Peptides:ACoVP100092   ACoVP100097   ACoVP100102   ACoVP100015   ACoVP100014

    Target Domain information
    Target Domain Full Name:Heptad repeat 1 (HR1) domain of Human coronavirus OC43 (HCoV-OC43) spike glycoprotein
    Target Type:glycoprotein
    UniprotID [Sequence]:

    P36334 [1004-1054]

    Target Synonyms:Alternative name(s) for spike glycoprotein: E2 Peplomer protein S glycoprotein
    Target Source:

    Human coronavirus OC43 (HCoV-OC43) : 31631

    Target Structure: