General information | |
ACovPid: | ACoVP100092 |
Trivial Name: | EK0-1 |
Amino Acids Sequence: | SLDYINVTFLDLQDEMKKLEEAIKKLEQSYINLKDI |
Length: | 36 |
C-Terminal Modification: | None |
N-Terminal Modification: | None |
Chemical Modification: | None |
Peptide Source: | Human coronavirus OC43 (HCoV-OC43) : 31631 |
Source Description: | Peptide OC43-HR2P was derived from the HR2 domain of HCoV-OC43. EK0-1 was the optimized form of OC43-HR2P. |
Against Virus: | Severe acute respiratory syndrome coronavirus (SARS-CoV) : 694009 |
Inhibition Value Type: | IC50 |
Inhibitory Effect: | 0.31 ± 0.03 |
Inhibitory Unit: | µM |
Target Domain Name: | HR1 domain of SARS-CoV |
Assay: | Cell-cell fusion |
Assay Description: | The inhibitory activity of a test peptide on HCoV S-mediated cell-cell fusion was determined. Briefly, effector cells (293 T/S/GFP) and target cells (Huh-7 cells) were cocultured in the presence or absence of a test peptide at the indicated concentrations for fusion. After counting the fused and unfused cells, the percentage of cell-cell fusion was calculated, as described above. The percent inhibition of cell-cell fusion was calculated using the following formula as described : [1 − (E − N)/(P − N)] × 100%. “E” represents the percentage of cell-cell fusion in the experimental group. “P” represents the percentage of cell-cell fusion in the positive control group, where 293 T/HCoV S/EGFP cells were used as effector cells, to which only PBS was added. “N” is the percentage of cell-cell fusion in negative control group, where 293 T/EGFP cells were used as effector cells. The IC50 was calculated using the CalcuSyn software provided by T. C. Chou. Samples were tested in triplicate, and all those experiments were repeated twice. |
Anti-CoV activity in vivo: | |
Reference: | 30989115 |
Comment: | |
3D structure: | |
Structure Experiment Verified: | NO |
Similar Peptides: | ACoVP100097   ACoVP100077   ACoVP100102   ACoVP100015   ACoVP100014 |
Target Domain information | |
Target Domain Full Name: | Heptad repeat 1 (HR1) domain of Severe acute respiratory syndrome coronavirus (SARS-CoV) spike glycoprotein |
Target Type: | glycoprotein |
UniprotID [Sequence]: | P59594 [902-952] |
Target Synonyms: | Alternative name(s) for spike glycoprotein: E2 Peplomer protein S glycoprotein |
Target Source: | Severe acute respiratory syndrome coronavirus (SARS-CoV) : 694009 |
Target Structure: | 1WNC, 1WYY, 1ZV7, 1ZV8, 1ZVB, 2AJF, 2BEQ, 2BEZ, 2DD8, 2FXP, 2GHV, 2GHW, 2RUM, 2RUN, 2RUO, 3BGF, 3D0G, 3D0H, 3D0I, 3SCI, 3SCJ, 3SCK, 3SCL, 5WRG, 5X4S, 5X58, 5X5B, 5XJK, 5XLR, 5ZVM, 6ACC, 6ACD, 6ACG, 6ACJ, 6ACK, 6CRV, 6CRW, 6CRX, 6CRZ, 6CS0, 6CS1, 6CS2, 6M3W, 6NB6, 6NB7, 6VW1, 6WAQ, 7JN5 |