General information
    ACovPid:ACoVP100080
    Trivial Name:OC43-HR2P
    Amino Acids Sequence:SLDYINVTFLDLQDEMNRLQEAIKVLNQSYINLKDI
    Length:36
    C-Terminal Modification:None
    N-Terminal Modification:None
    Chemical Modification:None
    Peptide Source:

    Human coronavirus OC43 (HCoV-OC43) : 31631

    Source Description:Peptide OC43-HR2P was derived from the HR2 domain of HCoV-OC43.
    Against Virus:

    Human coronavirus NL63 (HCoV-NL63) : 277944

    Inhibition Value Type:IC50
    Inhibitory Effect:0.94 ± 0.11
    Inhibitory Unit:µM
    Target Domain Name:HR1 domain of HCoV-NL63
    Assay:Cell-cell fusion
    Assay Description:293 T effector cells were transfected with plasmid pAAV-IRES-EGFP encoding the EGFP (293 T/EGFP cells) or plasmid pAAV-IRES-S-EGFP encoding the corresponding HCoV S protein (293 T/HCoV S/GFP cells) as the effector cells. Huh-7 cells, expressing various HCoV receptors on the membrane surface, were used as target cells, as described below. 1) MERS-CoV S-mediated cell-cell fusion: Effector cells (293 T/MERS-CoV/GFP) and target cells (Huh-7 cells) were cocultured in DMEM containing 10% FBS, at 37°C for 2 hours; 2) 229E S-mediated cell-cell fusion: Effector cells (293 T/229E/GFP) and target cells (Huh-7 cells) were cocultured in DMEM containing 10% FBS, at 37°C for 4 hours; 3) SARS-CoV and SL-CoV S-mediated cell-cell fusion: Effector cells (293 T/SARS-CoV/GFP or 293 T/SL-CoV/GFP) and target cells (Huh-7 cells) were cocultured in the presence of trypsin (80 ng/ml) in DMEM without FBS, at 37°C for 4 hours; 4) OC43 or NL63 S-mediated cell-cell fusion: Effector cells (293 T/HCoV-OC43/GFP or 293 T/HCoV-NL63/GFP) and target cells (Huh-7 cells) were cocultured in the presence of trypsin (80 ng/ml) in DMEM without FBS, at 37°C for 4 hours. Five fields in each well were randomly selected for counting the fused and unfused cells. The fused cells are at least twice as large as the unfused cells, and the fluorescence intensity in the fused cell became weak as a result of the diffusion of enhanced green fluorescent protein (EGFP) from one effector cell to target cells (see figs. S1D and S2C). The percentage of cell-cell fusion [(number of the fused cells/number of the fused and unfused cells) × 100%] was then calculated.
    Anti-CoV activity in vivo:
    Reference:30989115
    Comment:
    3D structure:

    StructureACoVP100080

    Structure Experiment Verified:NO
    Similar Peptides:ACoVP100092   ACoVP100097   ACoVP100102   ACoVP100015   ACoVP100014

    Target Domain information
    Target Domain Full Name:Heptad repeat 1 (HR1) domain of Human coronavirus NL63 (HCoV-NL63) spike glycoprotein
    Target Type:glycoprotein
    UniprotID [Sequence]:

    Q6Q1S2 [948-1067]

    Target Synonyms:Alternative name(s) for spike glycoprotein: E2 Peplomer protein S glycoprotein
    Target Source:

    Human coronavirus NL63 (HCoV-NL63) : 277944

    Target Structure:2IEQ, 3KBH, 5SZS, 7KIP