2151 Tobacco Etch Virus protease (TEV protease) Protein>Enzyme Tobacco etch virus (TEV):12227 2152 Histone deacetylase 8, HD8 Protein>Enzyme Unknown HD8 is a Zn2+-dependent histone deacetylase that has been implicated as a therapeutic target in various diseases including cancer, X-linked intellectual disability, and parasitic infections. 2153 C-terminal domain of CCN family member 2 Protein>Others P29279 Cellular communication network factor Connective tissue growth factor Hypertrophic chondrocyte-specific protein 24 Insulin-like growth factor-binding protein 8 IBP-8 IGF-binding protein 8 IGFBP-8 Homo sapiens (Human):9606 The recombinant fusion protein of CTGF/C and pKW-CTGF was prepared in the authors' laboratory. CTGF/C was purchased from PeproTech. 2154 Anti-F1 capsular antigen monoclonal antibody (YPF19) and human sera pool IgG of Alzheimer’s disease (AD) patients Miscellaneous Mus musculus (Mouse):10090 Homo sapiens (Human):9606 As a source of antibodies directed against possible conformational epitopes of human polymorphic β-amyloid 1−42 (Aβ1−42), it was decided to use a pool of 5 human sera from patients with AD (IgGAD) (mean age of 77.4 years, mean value of MMSE = 15.2). On the other hand, the monoclonal antibody YPF19 (AbDSerotec A Bio-Rad Company, IgG1-9820-5007) anti-Yersinia pestis F1 (reacting to Y. pestis F1 capsular antigen, Uniprot code P26948) was used to screen for putative conformational mimotopes homologous to Caf1 of Yersinia pestis. 2155 Fab A Protein>Monoclonal antibody Unknown Fab A was purchased from NovoNordisk. 2156 Fab A,Fab Z and Fab D Protein>Monoclonal antibody Unknown Fab A and Fab D were from NovoNordisk, and cell stock of Fab Z was kindly donated by Prof. P. Tessier. 2157 Copper ion, Cu(2+) Inorganic molecules or materials None 2158 Cowpea mosaic virus, CPMV Virus Cowpea mosaic virus (strain SB) (CPMV):928299 Cowpea mosaic virus (CPMV) was produced in Vigna unguiculata plants by infecting each primary leave with 4 μg of CPMV via mechanical inoculation (4 μg of CPMV was added per leaf in 40 μL of 0.1 M potassium phosphate buffer (pH 7.0) after leaves were dusted with carborundum).  2159 Purified serum IgG from human T-lymphotropic virus 1 (HTLV-1) infected people Miscellaneous Homo sapiens (Human):9606 Serum samples were taken from people living with human T-lymphotropic virus 1 (HTLV-1) from the Clinic of Infectious Diseases (Tropical Diseases) of the Center for Tropical Medicine, Institute of Health Sciences, Federal University of Pará (Universidade Federal do Pará). 2160 Ovomucoid Protein>Others P01005 Allergen Gal d I Gallus gallus (Chicken):9031 Ovomucoid purified from chicken egg white was obtained from Sigma-Aldrich (St. Louis, MO, USA). 2161 Microcentrifuge tube (polypropylene, PP) Inorganic molecules or materials None 2162 Boiled Daphnia magna asexual egg Miscellaneous Daphnia magna:35525 2163 Daphnia magna asexual egg Miscellaneous Daphnia magna:35525 2164 Prostate specific antigen (PSA(-/lo)) human prostate cancer cell line LNCaP Homo sapiens (Human):9606 2165 Human embryonic kidney cells 293 (HEK293 cells) transfected with free fatty acid receptor 1 (FFAR1) Homo sapiens (Human):9606 HEK293 cells were seeded in a 6-well plate at a density of 4.0e5 cells/well and incubated overnight. Expression vectors (pCAGGS/FFAR1) was kindly provided by Dr. Inoue (Tohoku University) and used for transfection. A mixture of 2.5 μg FFAR1 per well in 6-well plates was transfected using Lipofectamine 3000 reagent (L3000-008, Thermo Fisher Scientific, Waltham, MA, USA). 2166 Interleukin-33 (IL-33) Protein>Receptor O95760[117-270] Interleukin-1 family member 11 (IL-1F11) Nuclear factor from high endothelial venules (NF-HEV) IL-33 Homo sapiens (Human):9606 2KLL,4KC3 Interleukin-33 (IL-33) signaling occurs through a receptor complex of IL-1 receptor-like 1 (ST2) and plays an important role in allergy-causing inflammatory diseases by activating biological reactions via the interaction of IL-33 with the IL-33 receptor. IL-33, a member of the IL-1 cytokine family, is not only an intracellular nuclear factor but also an extracellular cytokine and it is expressed in various cell types, including epithelial cells, endothelial cells, mast cells, macrophages, fibroblasts, osteoclasts, and dendritic cells. 2167 Surfaces of crystalline gypsum 2168 Amyloid β peptide (Aβ) (M1-40) monomer, Aβ40 monomer Protein>Others Homo sapiens (Human):9606 Aβ was short for amyloid β peptide. Aβ(M1-40) with the sequence MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, here called Aβ40, was recombinantly expressed. Purified aliquots of Aβ40 were separately dissolved in 1 mL 6M GuHCl and monomers were isolated using size exclusion chromatography on a 10/300 Superdex 75 column (GE Healthcare) in 20 mM sodium phosphate, 0.2 mM EDTA, pH 8.0 (Aβ42) or pH 7.4 (Aβ40), in low-binding tubes (Axygen) on ice. The peptide concentration was determined by the integrated absorbance of the collected fraction. 2169 Amyloid β peptide (Aβ) (M1-40) fibril, Aβ40 fibril Protein>Others Homo sapiens (Human):9606 Aβ was short for amyloid β peptide. Aβ(M1-40) with the sequence MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, here called Aβ40, was recombinantly expressed.. Purified aliquots of Aβ40 were separately dissolved in 1 mL 6M GuHCl and monomers were isolated using size exclusion chromatography on a 10/300 Superdex 75 column (GE Healthcare) in 20 mM sodium phosphate, 0.2 mM EDTA, pH 8.0 (Aβ42) or pH 7.4 (Aβ40), in low-binding tubes (Axygen) on ice. Fibrils were prepared from the monomer solutions at quiescent condition at 37 °C in multiple wells of a PEG-ylated polystyrene 96-well plate (Corning 3881) with ThT in some wells. The ThT fluorescence was monitored through the bottom of the plate using a BMG Optima plate reader with excitation at 440 nM and emission at 480 nM until reaching the ThT plateau. Fibrils were collected from wells without ThT. 2170 Amyloid β peptide (Aβ) (M1-42) monomer, Aβ42 monomer Protein>Others Homo sapiens (Human):9606 Aβ was short for amyloid β peptide. Aβ(M1-42) with the sequence MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, here called Aβ42, was recombinantly expressed. Purified aliquots of Aβ42 were separately dissolved in 1 mL 6M GuHCl and monomers were isolated using size exclusion chromatography on a 10/300 Superdex 75 column (GE Healthcare) in 20 mM sodium phosphate, 0.2 mM EDTA, pH 8.0 (Aβ42) or pH 7.4 (Aβ40), in low-binding tubes (Axygen) on ice. 2171 Amyloid β peptide (Aβ) (M1-42) fibril, Aβ42 fibril Protein>Others Homo sapiens (Human):9606 Aβ was short for amyloid β peptide. Aβ(M1-42) with the sequence MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, here called Aβ42, was recombinantly expressed. Purified aliquots of Aβ42 were separately dissolved in 1 mL 6M GuHCl and monomers were isolated using size exclusion chromatography on a 10/300 Superdex 75 column (GE Healthcare) in 20 mM sodium phosphate, 0.2 mM EDTA, pH 8.0 (Aβ42) or pH 7.4 (Aβ40), in low-binding tubes (Axygen) on ice. Fibrils were prepared from the monomer solutions at quiescent condition at 37 °C in multiple wells of a PEG-ylated polystyrene 96-well plate (Corning 3881) with ThT in some wells. The ThT fluorescence was monitored through the bottom of the plate using a BMG Optima plate reader with excitation at 440 nM and emission at 480 nM until reaching the ThT plateau. Fibrils were collected from wells without ThT. 2172 Caspase-3, CASP-3 Protein>Enzyme P42574 Apopain Cysteine protease CPP32 (CPP-32) Protein Yama SREBP cleavage activity 1 (SCA-1) Homo sapiens (Human):9606 1CP3,1GFW,1I3O,1NME,1NMQ,1NMS,1PAU,1QX3,1RE1,1RHJ,1RHK,1RHM1RHQ,1RHR,1RHU,2C1E,2C2K,2C2M,2C2O,2CDR,2CJX,2CJY,2CNK,2CNL,2CNN,2CNO,2DKO,2H5I,2H5J,2H65,2J30,2J31,2J32,2J33,2XYG,2XYP,2XYH,2XZD,2XZT,2Y0B,3DEH,3DEI,3DEJ,3DEK,3EDQ,3GJQ,3GJR,3GJS,3GJT,3H0E,3ITN,3KJF,3PCX,3PD0,3PD1,4DCJ,4DCO,4DCP,4EHA,4EHD,4EHF,4EHH,4EHK,4EHL,4EHN,4JJE,4JQY,4JQZ,4JR0,4PRY,4PS0,4QTX,4QTY,4QU0,4QU5,4QU8,4QU9,4QUA,4QUB,4QUD,4QUE,4QUG,4QUH,4QUI,4QUJ,4QUL,5I9B,5I9T,5IAB,5IAE,5IAG,5IAJ,5IAK,5IAN,5IAR,5IAS,5IBC,5IBP,5IBR,5IC4,7XN4,7XN5,7XN6 Caspase-3, a cysteine-dependent protease, is considered a reliable molecular biomarker for the diagnosis and prognosis of apoptosis-related diseases. 2173 M2 macrophages Homo sapiens (Human):9606 Monocytes were isolated from peripheral blood mononuclear cells (PBMCs) using plastic adherence. PBMCs were purified from healthy donor buffy coats by density gradient centrifugation. To generate M1 macrophages, isolated monocytes were cultured in serum free X-vivo 15 medium (Lonza, Basel, Switzerland, Cat#BE02-060Q) supplemented with antibiotics, whereas complete RPMI medium was used for M2 macrophages. M1 and M2 macrophages were firstly primed by 50 ng/mL GM-CSF (Biotechne, R&D systems, Santa Clara, CA, USA, Cat#215-GM-010) and 50 ng/mL M-CSF (Biotechne, R&D systems, Cat#216-MC-035) for 4–6 days, respectively. Thereafter, the cells were cultured for additional two days in the presence of 50 ng/mL LPS and 100 U/mL IFN-gamma (M1) or 50 ng/mL IL-4 (Biotechne, R&D systems, Cat#204-IL/CF) and 1 ng/mL IL-10 (Biotechne, R&D systems, Cat#217-IL) (M2). Under these conditions, the cells displayed the morphological characteristics of M1 or M2 macrophages. 2174 Immunomodulatory protein Ling Zhi-8, LZ-8 Protein>Others P14945 Ganoderma lucidum (Ling zhi medicinal fungus) (Bracket fungus):5315 Studies have shown that LZ-8 can not only promote the proliferation of lymphocytes cells and affect the expression of cytokines, but also directly enter tumor cells and affect their physiological activities by regulating the expression of tumor genes, thereby killing tumor cells without damaging normal cells.  2175 Klebsiella pneumoniae KCTC 2208 cell Klebsiella pneumoniae KCTC 2208