1451 AYSSGAPPMPPF NPSSLFRYLPSD SLATQPPRTPPV 3 Phage display (common panning) 4 PMID:12618805 Silver nanoparticles Not determined. Not determined. Not determined. Ph.D.-12 phage display library (X12) 1452 KFLQFVCLGVGP AVLMQKYHQLGP IRPAIHIIPISH NVIRASPPDTSY LAMPNTQADAPF QQNVPASGTCSI NAMPGMVAWLCR HNTSPSPIILTP ASQTLLLPVPPL YNKDRYEMQAPP TLLLLAFVHTRH PWATAVSGCFAP SPLLYATTSNQS WSWRSPTPHVVT 14 Phage display (common panning) 4 DOI:10.1002/adfm.200304501 Silver nanoparticles Not determined. Not determined. Not determined. Ph.D.-12 phage display library (X12) The phages were washed in TBST buffer followed by elution with 0.2M glycine-HCl pH2.2. The phage-nanoparticles was incubated in lysis buffer to disrupt the phage coat, resulting in phage DNA release. The PCR reaction mix was directly added to the silver nanoparticles and placed in a thermocycler for PCR amplification. The PCR products were cloned into the TOPO vector. The clones were then sequenced using an automated DNA sequencer. 1453 HSVRWLLPGAHP HETNPPATIMPH WASAAWLVHSTI SPLQVLPYQGYV ESIPALAGLSDK GVLNAAQTWALS TPNSDALLTPAL HYPTLPLGSSTY HAMRPQVHPNYA QYKHHPQKAAHI YGNQTPYWYPHR HPPTDGMVPSPP TWQPFGMRPSDP TGDVSNNPNVTL 14 Phage display (common panning) 4 DOI:10.1002/adfm.200304501 Cobalt nanoparticles Not determined. Not determined. Not determined. Ph.D.-12 phage display library (X12) The phages were washed in TBST buffer followed by elution with 0.2M glycine-HCl pH2.2. The phage-nanoparticles was incubated in lysis buffer to disrupt the phage coat, resulting in phage DNA release. The PCR reaction mix was directly added to the silver nanoparticles and placed in a thermocycler for PCR amplification. The PCR products were cloned into the TOPO vector. The clones were then sequenced using an automated DNA sequencer. 1454 HSVRWLLPGAHP SAPNLNALSAAS SVSVGMKPSPRP SPLQVLPYQGYV SLTQTVTPWAFY TNLDDSYPLHHL TPNSDALLTPAL HYPTLPLGSSTY TQQTDSRPPVLL QYKHHPQKAAHI TFPSHLATSTQP QNFLQVIRNAPR KLHSSPHTPLVQ QLLPLTPSLLQA 14 Phage display (common panning) 4 DOI:10.1002/adfm.200304501 Cobalt nanoparticles Not determined. Not determined. Not determined. Ph.D.-12 phage display library (X12) The phages were washed several times in TBST buffer only. The phage-nanoparticles was incubated in lysis buffer to disrupt the phage coat, resulting in phage DNA release. The PCR reaction mix was directly added to the silver nanoparticles and placed in a thermocycler for PCR amplification. The PCR products were cloned into the TOPO vector. The clones were then sequenced using an automated DNA sequencer. 1455 GTSTFNSVPVRD SAPNLNALSAAS SVSVGMKPSPRP VPTNVQLQTPRS 4 Phage display (common panning) 4 DOI:10.1002/adfm.200304501 Cobalt nanoparticles Not determined. Not determined. Not determined. Ph.D.-12 phage display library (X12) 1456 KLWTIPQ(2) KLWTIPM(1) KLWVIPQ(2) KLWSIPR(1) KVWYITP(1) KVWVLPI(1) KVFLLPR(1) KVFNWPW(1) YSLRLDY(2) FDSLVAP(1) MESQGMK(1) SQLIPWS(1) SPSWEST(1) SPTPFLL(1) KFHTHFH(1) AHSTLMR(1) ITPLAWG(1) HDIRTTH(1) K-[LV]-W-x-I-P-x 18 Phage display (common panning) 5 DOI:10.1023/A:1005605808186 Interleukin-6, IL-6 Interleukin-6 receptor 1P9M, Not determined. Ph.D.-7 phage display library (X7) A synthetic oligopeptide, KLWTIPQ, was prepared but it did not inhibit growth of MH60, an IL-6 dependent cell line. In interaction between IL-6 and its two receptors (IL-6R and gp130), a peptide with two cysteine residues at each end of consensus sequence, GGCKLWTIPQCGG (PC), was also synthesized, which significantly inhibited cell growth of MH60 at over 100 μM and phosphorylation of Stat3, which is primary signal transducer and activator of transcription, phosphorylated by IL-6 signal. 1457 VVVGSLVVARLR(2) 1 Phage display (common panning) 3 PMID:10.3923/jbs.2007.1382.1387 Banana streak virus, BSV Not determined. Not determined. Not determined. Ph.D.-12 phage display library (X12) Bound phage was eluted with trypsin. 1458 SQSYPTRNS[1.006 ± 0.021] DQSYPADAN[NT] GGSQSYPDL[NT] EDGGAQSYP[NT] WRTAPESYP[NT] VQATLQSYP[NT] IHQSYPDRG[NT] REGAIQSYP[NT] RLTPESDDR[0.662 ± 0.025] QARYAKEPD[0.595 ± 0.042] QSYP, R-x(2)-P-E-P-D 10 Phage display (competitive panning) PMID:12545550 Anti-gp120 monoclonal antibody F105 Surface protein gp120, SU Not determined. Not determined. J404 phage display library (X9) ELISA Plates were coated with MAb F105 and negative control MAb F91 at 0.1 μg/well. Phage clones were added at 1.0e9 pfu/well. Parent phage M13KBst was a negative control. Phage binding was detected by rabbit anti-M13 antiserum, followed by AP-conjugated goat anti-rabbit secondary Ab. Absorbance values at 405 nm are reproduced from the bar graph and shown as the mean of duplicate samples ± standard deviations. The absorbance for the phage M13KBst was 0.053 ± 0.007. NT denotes not tested. Bound phages were eluted by the addition of rgp120. Phage display selection against MAb F105 resulted in a number of phage clones that matched the QSYP consensus sequence. Many phage clones selected by MAb F105 also matched the consensus RXXPEPD. 1459 AGPPYQSYP AMRDYQSYP SQSYPDR SQSYPD YMSYPNRSA YQSYPSREH [YS]-Q-S-Y-P, E-Q(2)-V-S-A-T-A-Q 6 Phage display (common panning) 3 PMID:12545550 Anti-rhodopsin monoclonal antibody 4B4 Rhodopsin Not determined. Not determined. J404 phage display library (X9) Phage screened against the MAb 4B4 sample resulted in the selection of two consensus sequences, with one consensus matching an epitope on the intradiskal face of rhodopsin, while the other sequence (QSYP) could not be mapped to rhodopsin. 1460 YMSYP TDWHYQSYP TDLQYQRYP TDWQYQSYP YQSYPSREN YDHNYQSYP HMSYP YQSYP, GPQV 7 Phage display (common panning) 3 PMID:12545550 Anti-cytochrome b-245 monoclonal antibody 449 Cytochrome b-245 Not determined. Not determined. J404 phage display library (X9) Phage selected during screening with the MAb 449 produced a consensus sequence GPQV matching an epitope on cytochrome b, as well as sequences containing the QSYP motif. 1461 YQSFP[NT] YMSYP[0.749 ± 0.040] YQSYV[NT] SQSYPDR[NT] TSYQSRPT[NT] GKSQYESYP[NT] GAVSYESYP[NT] NKTAYESYP[NT] YMSYPNRSA[NT] AMRDYQSYP[NT] TDWQYQSYP[0.424 ± 0.034] QKHYYESYP[NT] GDVMYMSYP[NT] YQSYP 13 Phage display (common panning) 3 PMID:12545550 Anti-MOMP monoclonal antibody GZD1E8 Major outer membrane porin, MOMP Not determined. Not determined. J404 phage display library (X9) ELISA Plates were coated with MAb GZD1E8 at 0.1 μg/well. Phage clones were added at 5e8 pfu/well. Parent phage M13KBst was a negative control. Phage binding was detected by rabbit anti-M13 antiserum, followed by AP-conjugated goat anti-rabbit secondary Ab. Absorbance values at 405 nm are reproduced from the bar graph and shown as the mean of duplicate samples ± standard deviations. The absorbance for the phage M13KBst was 0.064. NT denotes not tested. MAb GZD1E8 selected phage with the QSYP consensus, in addition to phage with a consensus sequence that maps to the C. pneumoniae major outer membrane protein. 1462 CWPLSHSVIVC(3)[1.504/1.407/1.609] CYPLNPEVYHC(2)[1.210/0.809] CSSVTAWTTGC(1)[2.304] CYMASGVFLC(1)[1.464] CWPLGPSTYIC(1)[0.865] CSLIASMETGC(1)[2.360] CYIGDPPENPC(1)[0.665] CWPLGDSTVIC(1)[1.713] CPLRLAFTFGC(1)[1.910] CTRMSHGYWIC(1)[2.015] 10 Phage display (common panning) 3 PMID:15131117 Anti-PSA monoclpnal antibody 30H12 Poly-α 2-8 sialic acid, PSA Not determined. Not determined. pVIII-9aa.Cys phage display library (CX9C) ELISA Reactivity of BSA-coupled peptides with 30H12 anti-PSA Ab was measured by ELISA tests. Absorbances at 492 nm were reproduced from the bar graph and shown. BSA-coupled MK6 and MK11 reverse peptides have values of A < 0.1 (data not shown). Authors tested mimotopes bioactivity in several in vitro and in vivo tests and demonstrated their ability to enhance PSA biological activity. 1463 IQSPHFF(6) SQLSGPQ(1) MHQGSNT(1) SILPYPY(3) GTPAPVN(1) HPTHTDP(2) KLPASLT(1) YAFTPPP(1) SDMGSLR(2) QLTNLRQ(2) TASYLTL(1) TELARKI(1) TKTDTWL(5) ASLNSNS(1) 14 Phage display (subtractive panning) 3 PMID:20052979 Octyltrimethoxysilane Not determined. Not determined. Not determined. Ph.D.-7 phage display library (X7) To obtain only those specific phage displayed peptides which identify the C8 ink,the eluted phages were subsequently incubated with a Si substrate, to screen out phages that bind to the background Si. 1464 LEHPFPK(1) EPLQLKM(1) GNTPSRA(3) QILAFNS(1) TFINPSH(1) GPLAKFP(1) LVQTFGK(1) HVPLLAT(1) GETRAPL(1) SILPYPY(1) YHQTTIT(1) AYSTLWP(1) AHLPPAQ(1) TTYSRFP(1) GIRHTNP(1) TTYSRFP(1) HAIYPRH(1) 17 Phage display (subtractive panning) 5 PMID:20052979 Octyltrimethoxysilane Not determined. Not determined. Not determined. Ph.D.-7 phage display library (X7) To obtain only those specific phage displayed peptides which identify the C8 ink,the eluted phages were subsequently incubated with a Si substrate, to screen out phages that bind to the background Si. 1465 HAIYPRH(4) LPIWRDF(1) TTYSRFP(2) QILAFNS(2) AYSTLWP(1) SILPYPY(2) GETRAPL(1) GIRHTNP(1) VYPHPER(1) GNTPSRA(1) 10 Phage display (subtractive panning) 6 PMID:20052979 Octyltrimethoxysilane Not determined. Not determined. Not determined. Ph.D.-7 phage display library (X7) To obtain only those specific phage displayed peptides which identify the C8 ink,the eluted phages were subsequently incubated with a Si substrate, to screen out phages that bind to the background Si. 1466 NSSPYLNTK(20) ASSLLASSP(16) PQSPGSSFP(10) PHNRQESPA(7) IPFPTLFAP(2) PHESDATVR(2) LVGTPNKTK(2) PSPSLSHPL(1) PPLKPVIDE(1) S(2)-[PLF] 9 Phage display (common panning) 3 PMID:7994916 Anti-TNF-α polyclonal antibody Tumor necrosis factor Not determined. Not determined. pVIII-9aa phage display library (X9) Biotinylated anti-human immunoglobulin was added to the reacted library for 3 h at room temperature and the immune complexes were immobilized in streptavidin-coated polystyrene tubes. Authors demonstrated that three synthetic peptides (ASSLLASSP, NSSPYLNTK and PPLKPVIDE) displayed by the selected phages reduced the binding of the autoantibodies to TNF-α protein by 50%. Interestingly, the sera of mice (BALB/c) immunized with phages displaying ASSLLASSP and NSSPYLNTK peptide showed an anti-TNF-α response as detected by ELISA. This response was not found in mice immunized with the wild type phage. Thus, the recombinant phages selected from the phage libraries could be used as carrier for immunization, and therefore as a tool for vaccine development. 1467 GLKVCHGPAGYPVCPCD(3) GTKRCFNVYPCQDIFVI(1) 2 Phage display (competitive panning) 2 PMID:30267550 Serum 14018 from patients sensitized to soy bean Not determined. Not determined. Not determined. ENTE-1 phage display library (GX3[C/S]X12) A trinucleotide‐based, 16mer peptide phagemid library covering >e9 clones (“ENTE‐1”) was used for two rounds of panning against individual serum from patients sensitized to soy bean. We coated 24 μg total serum protein in 2.5 mL PBS to Immuno Tubes (MaxiSorp™; Thermo Fisher Scientific, Waltham, MA, USA) for 1 hour at 4°C under constant agitation. Under these conditions, all Ig molecules should be bound on the tube surface. A negative control was incubated with PBS only. The coated tubes were washed with 2.5 mL blocking buffer once (5% [w/v] non‐fat dry milk powder in PBS) and incubated with 4 mL blocking buffer at 4°C for at least 15 minutes under constant agitation. Before adding the ENTE‐1 peptide phage display library, the tubes were washed three times with 4 mL PBS. To preferably select patient-specific antibodies, and in particular to prevent selection of peptides binding serum proteins, a competition with a mixture of ten sera from healthy donors was conducted. The ENTE‐1 library was added to each tube in 1 mL blocking buffer containing 30 μg of non‐allergic serum protein. In the first selection round, an amount of phage corresponding to 4e11 colony forming units (cfu) of ENTE‐1 library and in the second selection only e9‐e10 cfu of recovered phage were used. Tubes were incubated for 2 hour at 4°C with constant agitation, washed five times with 1 mL 0.1% (v/ v) Tween 20 in PBS in the first selection round, and with 0.5% (v/v) Tween 20 in PBS in the second selection round. 1468 VNWRGPSATLEGTNSNTGRRGQAVACRTCF(4) DERQIQRQEPMVRNSERDAMRCRTCAFKEL(2) TITNSASGLHFCKTCWKNSGGPAVAGKQDE(2) SLDRWPEHLATMGNRLGMTRQCKTCVGSTL(2) QRKESNPNLGCVTCGFRVRQTVGESDGGS(1) RYSGVVGNAVSEGERLNGLSSSCVTCLGWR(1) CRTCGEVGLMTRPGVRMNA(1) GAGQVERLREAKDPCRTCGGSRWRGEPFWM(1) VQWRWNDTEWMRCKTCMLSE(1) RHPHKRVRQYDGMRGAGGDWSCKTCLRPGY(1) PKRQISMERWLQVTQGEEVTPCATCNPWVA(1) LCKTCVRSHQERTVKGDQVTGTRICQTC(1) WDKRPVVWLRFEESQRLSRCATCGVGGVE(1) NVNEPGIRQGPAASVGWKVVRLAGICKTCV(1) GMKIVVFPKRSVPDVTGSQGAPPCRTCTST(1) SVLRQAAQFGNFELYVRREGNCRALTGCMR(1) C-[RK]-T-C 16 Phage display (common panning) 2 PMID:8700874 Anti-HBsAg monoclonal antibody H166 Hepatitis B surface antigen Not determined. Not determined. fNG1 phage display library (X30) 1469 EQFAKTCPMQAVKGGWASTLCRSVYSGNVR(2) RVAKGQGPLRVYLTQRRKQGNASWEWEEFI(2) LTEVVISRSADCRFRDVITGECCGWHRGCF(2) 3 Phage display (common panning) 2 PMID:8700874 Anti-HBsAg monoclonal antibody H5 Hepatitis B surface antigen Not determined. Not determined. fNG1 phage display library (X30) 1470 SPVSYGEWRARYCTNGGQGTVQRRADRSCW(23) RASGARARCEHRSGLSLSWQPSECSDSRTT(1) 2 Phage display (common panning) 2 PMID:8700874 Anti-HBsAg monoclonal antibody H35 Hepatitis B surface antigen Not determined. Not determined. fNG1 phage display library (X30) 1471 RGGLMRGGSSDTRLMGWQSSSIYSFQARGS(10) GSVPLSRRKEVWAGEEESFGYWLVNWQEMM(5) GRKTEKYSDGWTSMHSAEVCTQWNMSYCMI(3) GVELGKRANRGGSTTSWHGSSLGDIQSYWT(2) 4 Phage display (common panning) 2 PMID:8700874 Anti-HBsAg monoclonal antibody H53 Hepatitis B surface antigen Not determined. Not determined. fNG1 phage display library (X30) 1472 SLIPRGARTPRQCRSACPPREYSSADHWKS AGMWRVPRAENYSAPVRTRPKRQPWAQGSY LSADTLRSNSVDHDRVQNEVRSSRERRQPR LLEVGRDWVGGNNMWVGRMRERRKNERRQF IWDRRRQRQPGRVENYPVGKPASHQLYILN MKLPVDENKSGRRERRQPTPAGERELIRFD YLPYRAGVDKSGGREVGSHMRFFTRERRHA AELTGYEDVRRVEKRKGLAGTRERRQPAAY KMLRERRQPSSNLDYEKEVGQFYVVVAKSD SYGSGAARVSKLQETGGRRGRRQPSGSYIG FPARSEASGRQRRQPGRDVTHGEAVRVNIL IGPRRKWDALASDSGCNPSSHSQRCHRLKP PCQNTYRGLMLNEDCRQGRRTRRQPPATTL IGQGQQKEALGSRQRFDLRGRRQPVGSGKW RSGGVSELRAEGVNRRQARRKEQRRQPPRY RGSYDRRRERRQPRGLR QAVVSGERGARPRRQPRTPGVAACARSAGG QGYVDAGSISRFGGRGVWRQRRQPLLNGSF KIVRLTDAGHRTRRQPRTEEMWKVSTWLLN QVLKGGVSKRTMKGRACRQQACPKTVPSVV KELHTVEANERLKLREGRLRDRRQPISQWN R-G-R(2)-Q-P 21 Phage display (common panning) 4 PMID:8543161 Anti-HCV core protein monoclonal antibody 14-153-462 Hepatitis C core protein Not determined. Not determined. fNG1 phage display library (X30) 1473 PAPRSQESVGQTRVRVGRCEASRLGRSWCQ[1.621] GKVAARKSCTKFGRSCKVQTLWEGAGIPFI[0.600] ASARAYGECKYGRCTFNGIALPHSTMVKNP[1.516] PHWEGKVGCKRTRQGRASCSRVELDTKWGG[0.537] LARGGTSSMGWIEQGEVRWGCHNGRCSRIG[0.763] x-G-R 5 Phage display (common panning) 4 PMID:8543161 Anti-V3 loop of HIV gp120 monoclonal antibody 1001 V3 loop of HIV gp120 Not determined. Not determined. fNG1 phage display library (X30) ELISA Affinities of gpl20-mimic phages to anti-HIV mAb 1001 were measured by ELISA. Absorbance at 490 nm was determined, reproduced from the graph and shown. Phage fUSE2 was used as the negative control (with A490 of 0.052). The positive control well was coated with 0.5 μg of gpl20 (with A490 of 0.801). The results show that phage obtained are able to capture the anti-HIV mAb 1001. 1474 YPYPVFVH(1) YPYYQYFM(1) YPYGSYWA(1) VWYPYGAG(1) VWYKYPGW(1) DVFYPYPY(4) NRVWYPYG(1) NCQGTACS(1) LRCGWGVC(1) YNMYSTAA(1) AVNGCRHD(1) SYTHVASS(1) KGQAELLR(1) VFTDQKAQ(1) LNDNSAGY(1) WARNTSHS(1) YPY 16 Phage display (competitive panning) 3 PMID:1608948 Concanavalin-A, Con A Methyl α-D-mannopyranoside Not determined. Not determined. X8 fAFF1 phage display library Adherent phage were eluted with buffer containing methyl α-D-mannopyranoside or yeast mannan at concentrations sufficient to block rebinding of peptide at the sugar binding site. 1475 YNYGWVEF(5) YRYDIFRE(1) YDYGSFSK(1) YSYPYYHL(1) NYDYMGIW(1) YPYAYIWT(1) VVFYDYGS(1) YEAHYQYG(1) GTWFTNFR(1) SRCGLLVE(1) Y-x-Y 10 Phage display (common panning) 3 PMID:1608948 Concanavalin-A, Con A Methyl α-D-mannopyranoside Not determined. Not determined. X8 fAFF1 phage display library Biotinylated Con A was bound in 96-well microtiter plates coated with streptavidin. Each selection was carried on the plates. Bound phages were eluted with a low-pH citrate buffer (pH 3.0) to denature the receptor-ligand interaction.