1026 TIKGDSRPWTHTRGNVKHYWHAIRSIHMHDRLRSRDFG(1) PALMQEWWNGYAHKELLGPQDATSTHIMHNRIHEEQWD(1) PKLRWQGAAKLTYRFGVNPMYAMLRIYTSFGDHIPWKA(1) GSGGLLGRGGDGVQRISAMYDATHEPVDHSNAIPRAYY(1) ANCKJSDCPLIMWTMWAALHHAMJFRSWGDQFYTHDRS(1) FYRPLASWWHKLMYWFLRIGYARRSIPWQKHGANPMME(1) IEGGLSPRRMSMWEQLHKASDAKQPLLLFGHKANMWPI(1) NRRACMIRRLRIPLSRCHKKYARQLPAFGNBIVYAILH(1) PSRMYDRLHEGFSSWDQSSGNASWSQPTKALEIPGYNN(1) RMSDRLHLSRLPFGGWAQAANANDTPLMMREGSDRQGG(1) 10 Phage display (common panning) 3 PMID:9237207 Anti-PSM monoclonal antibody 7E11-C5 Glutamate carboxypeptidase 2 Not determined. Not determined. D38 phage display library 1027 SGTEGVCTKYSRSGWILTGFGCGASSAPHDREPTSGMHSNLHW(1) GVKGYQSDGGPVPEWPCHANGCGFKPNARKFMHARLRQKNEDW(1) DSQCGVGQCTGFGVCTNGPRGCGIHTLSMTNKLHTPTPPLHAS(1) LRGSASNTYIKHHFRNEAHTGCGKMIRRLRLHKSAGYCGITGS(1) RVFGGETSKGWKSSRMTHVEGCGMSARLHDSSCGSVNYYARPT(1) GYVDPGGVGSCYSMYPGLHRGCGALSHPSIRGPHPGASRRNVH(1) VFGGETSKGWKSMIGYLRSEGCGSRFGLWYCMMSAAIPLVTSN(1) RCSYTNKSAPMYGLLHDGEMGCGNSPSHIIERRIGGSLRPPFR(1) REEARLLMHYRLHKWYSSRAGCGNSNDPCDSRRRGRTHVINRS(1) MMWEQLHPEVCGRAYSTPKRGCGILGDRLHRRSPQYLTPPGR(1) 10 Phage display (common panning) 3 PMID:9237207 Anti-PSM monoclonal antibody 7E11-C5 Glutamate carboxypeptidase 2 Not determined. Not determined. DC43 phage display library 1028 SPEPDWFVEL(30) REPDWYEYVK(11) WHRWPWLVSG(1) WHWWYWALDR(1) EPDW 4 Phage display (common panning) 3 PMID:9237215 Streptavidin Biotin 1DF8,1LUQ,1MEP,1MK5,1N43,1N9M,1NDJ,1NQM,1STP,1SWD,1SWE,1SWG,1SWK,1SWN,1SWP,1SWR,1SWT,2F01,2GH7,2IZF,2IZG,2IZH,2IZI,2IZJ,2RTD,2RTE,2RTF,2RTG,2Y3F,3MG5, Not determined. X10 phage display library Streptavidin-binding peptides containing the consensus amino acid sequence motif EPDW were identified using a phage display library. Phage presenting peptides containing these sequences bound streptavidin in a biotin-sensitive fashion and could be eluted with biotin. Peptides with the WHWWXW motif are nuisance peptides. 1029 CVKWGKKEFC(1) CWQKYWGKEC(1) CYEWGKLRWC(1) CLRWGKWSNC(1) CWRWGKYQIC(1) CVSWGALKLC(1) CIRWGQNTFC(1) CWQWGNLKIC(1) CVRWGQLSIC(1) WGK 9 Phage display (common panning) 3 PMID:9237217 Calmodulin, CaM Not determined. Not determined. Not determined. R8C phage display library Four of the nine peptide sequences (CVKWGKKEFC, CWQKYWGKEC, CLRWGKWSNC and CIRWGQNTFC) were synthesized in cyclized, biotinylated form. All of the peptides required Ca2+ to bind CaM. The cyclized, disulfide-bonded form of CLRWGKWSNC bound CaM better than its reduced form or an analogue in which the cysteine residues were replaced by serine. The cyclized peptide also exhibited the ability to inhibit CaM-dependent kinase activity. 1030 ARVSFWRYSSFAPTY(11) LTLSHPHWVLNHFVS(4) NILSGFHYRNGDGRT(12) HGRFILPWWYAFSPS(38) SLYPGVFALIRSSYP(6) PGSHTPVPRAWAT(5) AREYGTRFSLIGGYR(8) RFRGLISLSQVYLSP(25) VAFVRTYVAGTGGFF(16) GPVWSSGLYRLFYAS(11) NHRLSSPRNPHLYAV(7) GCGRRYDVTCHYVFA(15) TFSGGHKWSISGRSA(11) VSIGFYGRVQYHS(6) 14 Phage display (common panning) 4 PMID:9238628 Thomsen-Friedenreich antigen (T antigen, TF antigen) Not determined. Not determined. Not determined. f3-15mer phage display library (X15) A random 15-amino acid bacteriophage display library was affinity selected against two proteins which display T antigen on their surfaces, asialofetuin and a BSA-T antigen conjugant. Asialofetuin contains three copies of T antigen exposed on its surface, while the BSA-T antigen conjugant has approximately 16 copies of T antigen chemically crosslinked to BSA. Four separate affinity selection procedures were performed with different combinations of antigen, washes and elution conditions. This is a pooled data for the 4 procedures. 1031 YLQASSSS(1) YLQASSSF(2) YLQASSSA(2) YLQASSSL(1) YLQASSSM(1) YLQASASV(1) YLQASAST(1) YLQASASH(1) YLQASTSH(1) YLQASTSF(1) YLQASLSA(1) YLQASLSP(1) YLQASESY(1) YLQASCSL(1) YLQASNSI(1) YLQASSTY(1) YLQASSVF(1) YLQASATY(1) YLQASLTA(1) YLQASMTC(1) YLQASMTQ(1) YLQASTTQ(1) YLQASVVG(1) YLQASAVP(1) YLQASQVF(1) YLQAAERY(1) YLQAHAIY(1) 27 Phage display (common panning) 6 PMID:9325241 Protease precursor, pPR Not determined. Not determined. Not determined. BPTI/Delta-g3p/biased 8-mer phage display library 1032 LVLASQ(1) LVLAST(2) LLCASV(1) GLILAS(1) LLWAST(1) PLVFAS(1) ALLFAS(1) LLMASV(1) LILASG(1) ELLLCS(1) LILASQ(1) LVLASN(1) GLVLAS(1) 13 Phage display (common panning) 6 PMID:9325241 Protease precursor, pPR Not determined. Not determined. Not determined. BPTI/Dg3p/6-mer phage display library 1033 PGYPWH LEYPWH 2 Phage display (common panning) 2-3 PMID:9328567 Anti-Hantaan virus glycoprotein G2 monoclonal antibody mAbGDO5 Glycoprotein G2 Not determined. Not determined. f3-6mer phage display library (X6) Petri dishes were coated with streptavidin and incubated with 5 to 10 mg of biotinylated antibody. Phage-antibody complexes were captured on streptavidin coated petri dishes. 1034 YSDLGK 1 Phage display (common panning) 3-4 PMID:9328567 Anti-P53 monoclonal antibody mAbBp53-11 Cellular tumor antigen p53 Not determined. Not determined. f3-6mer phage display library (X6) Petri dishes were coated with streptavidin and incubated with 5 to 10 mg of biotinylated antibody. Phage-antibody complexes were captured on streptavidin coated petri dishes. 1035 TDAFSDLGRMLANPG 1 Phage display (common panning) 2-3 PMID:9328567 Anti-P53 monoclonal antibody mAbBp53-11 Cellular tumor antigen p53 Not determined. Not determined. f3-15mer phage display library (X15) Petri dishes were coated with streptavidin and incubated with 5 to 10 mg of biotinylated antibody. Phage-antibody complexes were captured on streptavidin coated petri dishes. 1036 RLHYLF RHWSIF RHRTLF RHYLLF MSRHRN RHITLF RHITSL RLHTLF RHFTSL RHHTLL DGARLH 11 Phage display (common panning) 3 PMID:9350871 Phosphoenolpyruvate-protein phosphotransferase Phosphocarrier protein HPr 3EZA,3EZB,3EZE,2XDF, Not determined. f3-6mer phage display library (X6) The peptides were synthesized except RLHTLF, RHFTSL and RHHTLL. All of them inhibited the phosphotransferase system in vitro. 1037 KMSRHRKPGA SSLRGHRWVY KISRHGKRGK KISRHGRPTG RIHFIPRRGR NMSRHRKPTG NMSRHRNPGP NMSRHRIRPT NMSRHRNPTG 9 Phage display (common panning) 3 PMID:9350871 Phosphoenolpyruvate-protein phosphotransferase Phosphocarrier protein HPr 3EZA,3EZB,3EZE,2XDF, Not determined. X10 phage display library The peptides were synthesized except NMSRHRKPTG, NMSRHRNPGP, NMSRHRIRPT and NMSRHRNPTG. All of them inhibited the phosphotransferase system in vitro. 1038 GLRFGKTRVHYLVLG SGRKSTRVHHWLLVL SGRLSSWVHVGWLVL GLRLKGTRVHYGWVL MRLLKSTLCLVSLCG MRLLKGTLCFVGLCG 6 Phage display (common panning) 3 PMID:9350871 Phosphoenolpyruvate-protein phosphotransferase Phosphocarrier protein HPr 3EZA,3EZB,3EZE,2XDF, Not determined. f3-15mer phage display library (X15) The peptides were synthesized except GLRLKGTRVHYGWVL and MRLLKGTLCFVGLCG. All of them inhibited the phosphotransferase system in vitro. 1039 SDTRGDPVFNLPFQ(7) APVDSVFDRAFSAYL(3) TGLPSSDRAFLVSVS(1) LRDPVFNIAAGVAL(1) LDDPVFGFARRVPV(1) VGSFFALGDRAFLGL(1) MCAVRDPAFSRSRLS(2) LSSARSPRSLDRAFV(2) GGFSSDPGFLLRPRV(1) LMDPVFGFDRRVPF(1) LLDPSFDYFQLYTT(1) DFGPLFSDPGFRSAS(1) GPLDRAFSWRLNPRV(1) RMCSLDLGFCQTILR(1) GVRLLSGVFSDPAFA(1) LMDPVFGFDRRVPV(1) VHLDSAFWFVRTDFD(1) GGFSSDPGFLLRPRG(1) SPDDPAFRFAPYFTP(1) WRTFSRVDRAFFL(1) 20 Phage display (common panning) 3 PMID:9356343 Anti-preS1 monoclonal antibody MA18/7 PreS1 of Large envelope protein Not determined. Not determined. f3-15mer phage display library (X15) All phage mimotopes competed with recombinant HBsAg particles containing the pre-S1 region for binding to MA 18/7. Mouse antisera raised against four mimotopes from the phage display library reacted with HBsAg particles containing pre-S sequences. 1040 HRWWWSPR(2) HRFWWTFR(1) HRWCNFLR(1) KHRWWYQW(1) HKWRWWAF(1) HKKFSSGR(1) HGWLRWFS(1) TNARQTGR(1) AGGGLGRW(1) YHWPAWGQ(1) 10 Phage display (common panning) 3 PMID:9373320 Anti-C5a monoclonal antibody 2925 C5a anaphylatoxin Not determined. Not determined. X8 phage display library MAb 2925 was purified from cell culture supernatant. Biotinylated fabs of mAb 2925 were used in biopanning. The first round of biopanning was performed on 35-mm polystyrene Petri dishes coated with 10 mg streptavidin. In the second and third round the biotinylated Fab fragment was prereacted with phage in solution in a tube. 1041 HRWWWSPR(7) HKWRWWAL(8) HRLYWWRI(3) HRLKWWLG(1) HGRWWLRG(1) YHWAHWVR(1) HSKWWVFR(1) HRWWWSPR(10) HRFWWTFR(1) HKRWYFN(1) HKFRWHR(1) 13 Phage display (common panning) 4 PMID:9373320 Anti-C5a monoclonal antibody 2925 C5a anaphylatoxin Not determined. Not determined. X8 phage display library MAb 2925 was purified from cell culture supernatant. Biotinylated fabs of mAb 2925 were used in biopanning. The first round of biopanning was performed on 35-mm polystyrene Petri dishes coated with 10 mg streptavidin. In the second, third and fourth round the biotinylated Fab fragment was prereacted with phage in solution in a tube. Round four was done using 250 ng/ml Fab 2925 (5 nM). Next day, 400 μl TBS/Tween were added and the whole volume was pipetted onto streptavidin coated plates (15 min at RT). 1042 RAVCSRVIPGCGADSPSPLYLDETRP(3) HHGGGQDYEGGGESLIFHEYVPG(1) NKVRNVHDTVGGGNRLILSEYTI(3) VTPGAMILVEGGVSPKGARCTDL(1) 4 Phage display (common panning) 3 PMID:9373326 Anti-c-myc monoclonal antibody MYC-X-5/1 Myc proto-oncogene protein Not determined. Not determined. TSAR-12 phage display library 1043 PGIIISEEPPWD(1) GHMLPLILDESA(1) GLILSEGEEDVG(1) IVVVPEKLVLSE(1) 4 Phage display (common panning) 3 PMID:9373326 Anti-c-myc monoclonal antibody MYC-X-5/1 Myc proto-oncogene protein Not determined. Not determined. CWl phage display library 1044 RNVPPIFNDVYWIAF(31) RHVAAAVFVGWAFSV(3) TEFLWGFRTVFHG(2) TRWGESDSFRISPPG(1) PGAVRFTFGGSWHY(1) GGWGQFRLFYGAPFD(1) CSSEYGVTYWVLCA(1) IGRIVHHSLYSWPS(1) ECHFLFLLCRVWGR(1) WSVRYDYLVYPSLLP(1) SSGFRDAFRGWDGSA(1) SDVHYIHAHWAVTSH(1) SAVSVLGYHSYFVFP(1) GSFIIFFLVLFMLV(1) PVRYGFSGPRLAILW(1) AARTLSFHPYGYPPY(1) GHGLYYWNFTYSSET(1) TEFLWFRTVLHG(1) LSGGFVWMGFRPSIG(1) RNQGGNWMRFMRCLL(1) VSWSFYRIFGHPGTD(1) LSWSIDYNRNTPSIG(1) 22 Phage display (common panning) 4 PMID:9045678 Caveolin-1 Not determined. Not determined. Not determined. f3-15mer phage display library (X15) The GST-caveolin-1-(61-101) fusion protein was purified and immobilized on glutathione-agarose beads. All phage clones tested only interacted with the peptide that corresponds to the caveolin-scaffolding domain (residues 82-101) and with recombinant full-length caveolin-1 purified from E. coli. 1045 MWHWEKRKWV(13) KWAWGLDRWV(2) HWAWEVRMWR(2) MWRWESCCWE(1) MWVWEHNAWE(1) VWSWALRKWV(1) VWHWAVSRFN(1) MWRWESSRWE(1) RWHWQSHMWL(1) KWLWGSSRWE(1) RDWVGWVCL(1) W-x-W-x(4)-W 11 Phage display (common panning) 4 PMID:9045678 Caveolin-1 Not determined. Not determined. Not determined. [SC]X10[SC] phage display library The GST-caveolin-1-(61-101) fusion protein was purified and immobilized on glutathione-agarose beads. All phage clones tested only interacted with the peptide that corresponds to the caveolin-scaffolding domain (residues 82-101) and with recombinant full-length caveolin-1 purified from E. coli. 1046 GWRPDF(1) MWRPDF(9) WRPDFG(1) WRPFEL(1) 4 Phage display (common panning) 3 PMID:9419019 Anti-FIV monoclonal antibody 3e3 Envelope glycoprotein gp150 Not determined. Not determined. f3-6mer phage display library (X6) Each round was performed using a different solid support. Panning 1: streptavidin magnetic beads (100 μl, Promega) plus 10 μg biotinylated mAb in 100 μl Tris buffered (50 mM) saline (0.15 M) containing 0.1% Tween-20 (TBS-Tw). Panning 2: biotinylated mAb (10 μg) on petri dishes coated with streptavidin (10 μg in 1 ml bicarbonate buffer, 10 M, pH 8.5) and blocked with 1% BSA. Panning 3: 1 ug mAb directly coated on tosyl-activated magnetic beads (Dynal) according to the manufacturer\'s instructions. 1047 YMSVSNSILSWYNSP(1) EDNSPMLMWFNKTWS(1) LKWYNQQF(1) PEVRAQDGLPWYLWK(1) DATDAGWNKLPWYRS(1) SPETPWYQALFYSGR(1) AGSYWCKAWGLDCTS(28) 7 Phage display (common panning) 3 PMID:9430247 Anti-gp120 monoclonal antibody A32 Surface protein gp120, SU Not determined. Not determined. f3-15mer phage display library (X15) 1048 WYFDYHWDRTPISRA RPWNDKSPKNLWYNS GLEGLVPEQMKWYNS RGRKLESSWYNTVWR TESPGWNVPWIAVKW IRHAKVPWYHYPGGR 6 Phage display (competitive panning) 3 PMID:9430247 Anti-gp120 monoclonal antibody 19b Surface protein gp120, SU Not determined. Not determined. f3-15mer phage display library (X15) The HIV-1 gpl20 V3 region peptide CSIHIGPGRAFYTTGC was used in competition for human MAb 19b binding. 1049 SRGFYVQQMHISLES ARSFFIGQANVAMVS FSRNFFFSAGQQVQM MVFMEGNGRSFYYKL 4 Phage display (competitive panning) 3 PMID:9430247 Anti-gp120 monoclonal antibody 19b Surface protein gp120, SU Not determined. Not determined. f3-15mer phage display library (X15) The HIV-1 gpl20 V3 region peptide CYQKRKRIHIGPGRAFYTTC was used in competition for human MAb 19b binding. 1050 WLMRMAAWPWDYTQL NLRSTSFFELWAKWP GEFPDWDNLPLLCEG GRPQWYLQFEDYWRS DSLRVDEHHEVWVPM DWVPFFGFFFSRLQLP NWPRWWEEFVDKHSS FVWEEHVGFLMRN NWPRWEEFVDKHSS CVFYANVEEEVQCWL CLPAYGCKSFREPF GAQVNRKCAWHPRHI VAKKLWVPQVSGSNF HHGVYR 14 Phage display (common panning) 3 PMID:9430247 Anti-gp120 monoclonal antibody b12 Surface protein gp120, SU Not determined. Not determined. f3-15mer phage display library (X15)