976 Hydroxyapatite, HA Inorganic molecules or materials None 977 ICR male mice brain Organ and tissue Mus musculus (Mouse):10090 978 AC3 Protein>Others B5B3X0 Tomato leaf curl Kerala virus:551531 979 The first and second extracellular loops of CCR5 Protein>Others None The amino acid sequences of the first and second extracellular loops of CCR5 (YAANEWVFGNI, RSQKEGFHYTCSPHFPHTQYHFWKSFQTLK) were synthesized by GLS Company (Shanghai, China). 980 Anti-PSA monoclonal antibody Protein>Monoclonal antibody Unknown 981 Human ovarian tumor cell line SK-OV-3 Cell Homo sapiens (Human):9606 982 Lead Ion, Pb(2+) Inorganic molecules or materials None 983 Anti-HMW-MAA monoclonal antibody VT80.12 Protein>Monoclonal antibody Mus musculus (Mouse):10090 984 Anti-HMW-MAA monoclonal antibody VF1-TP43 Protein>Monoclonal antibody Mus musculus (Mouse):10090 985 Major outer membrane protein Protein>Others Q6J0N9 Leptospira noguchii serovar Pomona:280502 986 Anti-VSG LiTat 1.5 monoclonal antibody H12H3 Protein>Monoclonal antibody Mus musculus (Mouse):10090 The mAb H12H3 belongs to the IgG3 subclass. 987 Anti-VSG LiTat 1.3 monoclonal antibody H13F7 Protein>Monoclonal antibody Mus musculus (Mouse):10090 The mAb H13F7 belongs to the IgG3 subclass. 988 Anti-VSG LiTat 1.3 monoclonal antibody H18C11 Protein>Monoclonal antibody Mus musculus (Mouse):10090 The mAb H18C11 belongs to the IgG1 subclass. 989 Human antimicrobial peptide LL-37 Protein>Others Homo sapiens (Human):9606 LL-37 is the only member of the human cathelicidin antimicrobial peptide family and is commonly expressed in various tissues, including epithelium. The sequence of LL-37 is [LL-37, 37 aa] 990 Rabbit chondrocyte Cell Oryctolagus cuniculus (Rabbit):9986 991 Heparan sulfate, HS Organic molecules or materials Homo sapiens (Human):9606 992 3-O-sulfated heparan sulfate, 3-OS HS Organic molecules or materials Homo sapiens (Human):9606 993 Mouse adipose stromal cells, ASCs Cell Mus musculus (Mouse):10090 994 Mouse lung stromal cells, LSCs Cell Mus musculus (Mouse):10090 995 Etoposide, VP-16 Miscellaneous None Etoposide (VP-16) is a semi-synthetic derivative of podophyllotoxin that was originally isolated from the herbaceous perennial plant Podophyllum peltatum. This compound stabilizes DNA-topoisomerase II (top II) cleavage complexes and arrests cell cycle in S or G2/M phase, which results in apoptotic cell death. 996 Lipoate-protein ligase A Protein>Enzyme P32099 Lipoate--protein ligase EC=2.7.7.63 Escherichia coli (strain K12):83333 1X2G, 1X2H, 3A7A, 3A7R E. coli lipoic acid ligase (LplA) catalyzes ATP-dependent covalent ligation of lipoic acid onto specific lysine sidechains of three acceptor proteins involved in oxidative metabolism. 997 CSF samples from neurocysticercosis patient #1 Miscellaneous Homo sapiens (Human):9606 998 CSF samples from neurocysticercosis patient #2 Miscellaneous Homo sapiens (Human):9606 999 Melanoma-derived growth regulatory protein Protein>Others Q16674 Melanoma inhibitory activity protein Homo sapiens (Human):9606 1HJD, 1I1J, 1K0X 1000 Anti-JEV E protein monoclonal antibody E3.3 Protein>Monoclonal antibody Mus musculus (Mouse):10090