| General information | |
| TUP ID: | 891 |
| TUP Sequence: | RSFSVTSYSNGRSVGQVEPAGRRSQPPDVTRPRRS |
| Library: | X9 E. coli bacterial display library |
| Bind to: | Zinc ion, Zn(2+) |
| TUP Type: | Selection-related TUP |
| Experimentally-verified: | No |
| Reference: | PMID: 11722894 |
| Description: | The isolated sequence showed no similarity to known Zn(2+)-binding proteins, indicating that completely novel Zn(2+)-binding peptide sequences had been isolated. By changing the protein scaffold system, we demonstrated that the Zn(2+)-binding seems to be uniquely mediated by the peptide insert and to be independent of the sequence of the carrier protein. |
| Curator: | Bifang He |
| Curation Date: | 2019-03-21 |