| General information |
| TUP ID: | 1441 |
| TUP Sequence: | SSRLAYDHYFPSWRSYIFPGSNSSYYNNSWPTITMETN |
| Library: | TSAR-9 phage display library (X18PGX18) |
| Bind to: | 96-well immunoassay plate (polystyrene, PS) |
| TUP Type: | Selection-related TUP |
| Experimentally-verified: | No |
| Reference: | PMID: 7737512 |
| Description: | The plastic-binding phage bind to both unblocked plastic (polystyrene, PS and polyvinyl chloride, PVC) and plastic blocked with bovine serum albumin (BSA) but require non-ionic detergent to bind to plastic blocked with milk. |
| Curator: | Bifang He |
| Curation Date: | 2019-07-25 |