General information | |
ACovPid: | ACoVP100489 |
Trivial Name: | EK1 |
Amino Acids Sequence: | SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKEL |
Length: | 36 |
C-Terminal Modification: | None |
N-Terminal Modification: | None |
Chemical Modification: | None |
Peptide Source: | Human coronavirus OC43 (HCoV-OC43) : 31631 |
Source Description: | Peptide OC43-HR2P was derived from the HR2 domain of HCoV-OC43. EK1 was the optimized form of OC43-HR2P,and EK1C4 was the optimized form of EK1. |
Against Virus: | |
Inhibition Value Type: | IC50 |
Inhibitory Effect: | ~0.002 |
Inhibitory Unit: | µM |
Target Domain Name: | HR1 domain of SARS-CoV-2 |
Assay: | Plaque reduction assay |
Assay Description: | Titers of virus stocks were determined by plaque assay in Vero E6 cells grown in six-well tissue culture plates. Virus stocks were serially diluted 10-fold in PBS, and 0.2 ml of each dilution was inoculated into quadruplicate wells and allowed to adsorb at 37°C for 1 h with rocking every 15 min. Monolayers were rinsed with Dulbecco’s phosphate-buffered saline (DPBS; Corning) and then overlaid with a semisolid medium containing MEM, 5% FBS, antibiotics, and ME agarose (0.6%). Cultures were incubated at 37°C for 3 days and overlaid with DPBS containing neutral red (3.33 g/liter; Thermo Fisher Scientific) as a stain (10%), and plaques were counted after 4 to 5 h. Peptides were tested for inhibitory activity against SARS-CoV-2 and MERS-CoV by plaque reduction neutralization assay. Peptides were serially diluted in molecular biology grade water (10,000 nM through 5 nM or 1,000 nM through 0.5 nM), each peptide dose was mixed with an equal volume of virus containing 500 particle-forming units (PFU)/ml in MEM, and the peptide/virus mixtures were incubated at 37°C for 1 h. Each peptide dose/virus mixture was inoculated into triplicate wells of Vero E6 cells in six-well plates (0.2 ml per well) and allowed to adsorb at 37°C for 1 h with rocking every 15 min. Monolayers were rinsed with DPBS prior to the addition of medium overlay containing MEM, 5% FBS, antibiotics, and ME agarose (0.6%). Cultures were incubated at 37°C for 3 days and overlaid with medium containing neutral red as a stain, and plaques were counted after 4 to 5 h. Virus controls were mixed with sterile water instead of peptide. |
Anti-CoV activity in vivo: | |
Reference: | 33082259 |
Comment: | |
3D structure: | |
Structure Experiment Verified: | NO |
Similar Peptides: | ACoVP100015   ACoVP100014   ACoVP100013   ACoVP100001   ACoVP100011 |
Target Domain information | |
Target Domain Full Name: | Heptad repeat 1 (HR1) domain of Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) spike glycoprotein |
Target Type: | glycoprotein |
UniprotID [Sequence]: | P0DTC2 [920-970] |
Target Synonyms: | Alternative name(s) for spike glycoprotein: E2 Peplomer protein S glycoprotein |
Target Source: | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) : 2697049 |
Target Structure: | 6LVN, 6LXT, 6LZG, 6M0J, 6M17, 6M1V, 6VSB, 6VW1, 6VXX, 6VYB, 6W41, 6WPS, 6WPT, 6X29, 6X2A, 6X2B, 6X2C, 6X6P, 6X79, 6XC2, 6XC3, 6XC4, 6XC7, 6XCM, 6XCN, 6XDG, 6XE1, 6XEY, 6XF5, 6XF6, 6XKL, 6XKP, 6XKQ, 6XLU, 6XM0, 6XM3, 6XM4, 6XM5, 6XR8, 6XRA, 6XS6, 6YLA, 6YM0, 6YOR, 6YZ5, 6YZ7, 6Z2M, 6Z43, 6Z97, 6ZB4, 6ZB5, 6ZBP, 6ZCZ, 6ZDG, 6ZDH, 6ZER, 6ZFO, 6ZGE, 6ZGG, 6ZGI, 6ZH9, 6ZHD, 6ZLR, 6ZOW, 6ZOX, 6ZOY, 6ZOZ, 6ZP0, 6ZP1, 6ZP2, 6ZP5, 6ZP7, 6ZWV, 6ZXN, 7A25, 7A29, 7A4N, 7A5R, 7A5S, 7A91, 7A92, 7A93, 7A94, 7A95, 7A96, 7A97, 7A98, 7AD1, 7BWJ, 7BYR, 7BZ5, 7C01, 7C2L, 7C8D, 7C8V, 7C8W, 7CAB, 7CAH, 7CAI, 7CAK, 7CAN, 7CDI, 7CDJ, 7CH4, 7CH5, 7CHB, 7CHC, 7CHE, 7CHF, 7CHH, 7CJF, 7CN9, 7CT5, 7CWM, 7CWN, 7CWO, 7CWS, 7CWU, 7DCC, 7DCX, 7DD2, 7DD8, 7DDD, 7DDN, 7DF3, 7DF4, 7DK3, 7DK4, 7DK5, 7DK6, 7DK7, 7DMU, 7JJC, 7JJI, 7JJJ, 7JMO, 7JMP, 7JMW, 7JV2, 7JV4, 7JV6, 7JVA, 7JVB, 7JVC, 7JW0, 7JWB, 7JWY, 7JX3, 7JZL, 7JZM, 7JZN, 7JZU, 7K43, 7K45, 7K4N, 7K8M, 7K8S, 7K8T, 7K8U, 7K8V, 7K8W, 7K8X, 7K8Y, 7K8Z, 7K90, 7K9Z, 7KDG, 7KDH, 7KDI, 7KDJ, 7KDK, 7KDL, 7KE4, 7KE6, 7KE7, 7KE8, 7KE9, 7KEA, 7KEB, 7KEC, 7KJ2, 7KJ3, 7KJ4, 7KJ5, 7KKK, 7KKL, 7KL9, 7KMB, 7KMS, 7KMZ, 7KNB, 7KNE, 7KNH, 7KNI, 7L02, 7L06, 7L09 |