General information
    ACovPid:ACoVP100442
    Trivial Name:LL37
    Amino Acids Sequence:[LL-37, 37 aa]
    Length:37
    C-Terminal Modification:None
    N-Terminal Modification:None
    Chemical Modification:None
    Peptide Source:

    Cathelicidin antimicrobial peptide (Human) (hCAP-18) : 9606

    Source Description:The LL37 peptide is derived from the hCAP-18 protein, which is encoded by the CAMP gene.
    Against Virus:

    Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) : 2697049

    Inhibition Value Type:IC50
    Inhibitory Effect:4.74
    Inhibitory Unit:µg/mL
    Target Domain Name:RBD of SARS-CoV-2
    Assay:Pseudotyped virus infection inhibition assay
    Assay Description:HEK-293T-hACE2 cells obtained from Prof. Ye and A549 cells purchased from the Cell Bank of the Chinese Academy of Sciences (CAS, Shanghai, China) were cultured in Dulbecco’s modified Eagle’s medium (DMEM, Gibco, Thermo Fisher Scientific, Shanghai, China) containing 10% fetal bovine serum (FBS, Gibco). Cells were seeded into a 96-well plate at a density of 5 × 10^3 cells/well and cultured overnight. To determine IC50, SARS-CoV-2 S pseudovirions expressing a dual-luciferase reporter (1 × 10^6 TU, Tsingke Biotechnology, Beijing, China) were pretreated with increasing concentrations of LL37 (100, 75, 50, 25, 12.5, 6.25, 3.13, 1.56, 0.78, and 0.39 µg/mL) at 37 °C for 15 min. After three washes with sterile PBS, HEK-293T-hACE2 cells were coincubated with pseudovirions at 37 °C for 12 h. The cells were further cultured for 48 h in DMEM containing 10% FBS after the removal of pseudovirions. To evaluate the effect of ACE2 cloaking on pseudovirion invasion, A549 and HEK-293T-hACE2 cells were preincubated with LL37 (1, 5, and 10 µg/mL) at 37 °C for 24 h and were then exposed to pseudovirions for 48 h. Luciferase activity was measured using a dual-luciferase reporter assay system (E1910, Promega, Beijing, China). Experiments were conducted in triplicate and repeated twice.
    Anti-CoV activity in vivo:
    Reference:33849267
    Comment:
    3D structure:

    StructureACoVP100442

    Structure Experiment Verified:NO
    Similar Peptides:

    Target Domain information
    Target Domain Full Name:Receptor-binding domain (RBD) of Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) spike glycoprotein
    Target Type:glycoprotein
    UniprotID [Sequence]:

    P0DTC2 [319-541]

    Target Synonyms:Alternative name(s) for spike glycoprotein: E2 Peplomer protein S glycoprotein
    Target Source:

    Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) : 2697049

    Target Structure:6LVN, 6LXT, 6LZG, 6M0J, 6M17, 6M1V, 6VSB, 6VW1, 6VXX, 6VYB, 6W41, 6WPS, 6WPT, 6X29, 6X2A, 6X2B, 6X2C, 6X6P, 6X79, 6XC2, 6XC3, 6XC4, 6XC7, 6XCM, 6XCN, 6XDG, 6XE1, 6XEY, 6XF5, 6XF6, 6XKL, 6XKP, 6XKQ, 6XLU, 6XM0, 6XM3, 6XM4, 6XM5, 6XR8, 6XRA, 6XS6, 6YLA, 6YM0, 6YOR, 6YZ5, 6YZ7, 6Z2M, 6Z43, 6Z97, 6ZB4, 6ZB5, 6ZBP, 6ZCZ, 6ZDG, 6ZDH, 6ZER, 6ZFO, 6ZGE, 6ZGG, 6ZGI, 6ZH9, 6ZHD, 6ZLR, 6ZOW, 6ZOX, 6ZOY, 6ZOZ, 6ZP0, 6ZP1, 6ZP2, 6ZP5, 6ZP7, 6ZWV, 6ZXN, 7A25, 7A29, 7A4N, 7A5R, 7A5S, 7A91, 7A92, 7A93, 7A94, 7A95, 7A96, 7A97, 7A98, 7AD1, 7BWJ, 7BYR, 7BZ5, 7C01, 7C2L, 7C8D, 7C8V, 7C8W, 7CAB, 7CAH, 7CAI, 7CAK, 7CAN, 7CDI, 7CDJ, 7CH4, 7CH5, 7CHB, 7CHC, 7CHE, 7CHF, 7CHH, 7CJF, 7CN9, 7CT5, 7CWM, 7CWN, 7CWO, 7CWS, 7CWU, 7DCC, 7DCX, 7DD2, 7DD8, 7DDD, 7DDN, 7DF3, 7DF4, 7DK3, 7DK4, 7DK5, 7DK6, 7DK7, 7DMU, 7JJC, 7JJI, 7JJJ, 7JMO, 7JMP, 7JMW, 7JV2, 7JV4, 7JV6, 7JVA, 7JVB, 7JVC, 7JW0, 7JWB, 7JWY, 7JX3, 7JZL, 7JZM, 7JZN, 7JZU, 7K43, 7K45, 7K4N, 7K8M, 7K8S, 7K8T, 7K8U, 7K8V, 7K8W, 7K8X, 7K8Y, 7K8Z, 7K90, 7K9Z, 7KDG, 7KDH, 7KDI, 7KDJ, 7KDK, 7KDL, 7KE4, 7KE6, 7KE7, 7KE8, 7KE9, 7KEA, 7KEB, 7KEC, 7KJ2, 7KJ3, 7KJ4, 7KJ5, 7KKK, 7KKL, 7KL9, 7KMB, 7KMS, 7KMZ, 7KNB, 7KNE, 7KNH, 7KNI, 7L02, 7L06, 7L09